[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : wbtF
DDBJ      :wbtF         NAD dependent epimerase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  827/915 : Eukaryota  188/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:323 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   14->322 1sb9A PDBj 3e-87 53.1 %
:RPS:PDB   15->323 1e7rA PDBj 2e-45 19.3 %
:RPS:SCOP  14->321 1sb8A  c.2.1.2 * 4e-86 53.2 %
:HMM:SCOP  13->321 1eq2A_ c.2.1.2 * 5e-93 43.2 %
:RPS:PFM   15->248 PF01370 * Epimerase 2e-41 44.6 %
:HMM:PFM   15->253 PF01370 * Epimerase 1.5e-62 42.7 234/238  
:BLT:SWISS 14->321 VIPB_SALTI 4e-78 50.0 %
:PROS 231->238|PS00867|CPSASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31315.1 GT:GENE wbtF GT:PRODUCT NAD dependent epimerase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1611276..1612247) GB:FROM 1611276 GB:TO 1612247 GB:DIRECTION - GB:GENE wbtF GB:PRODUCT NAD dependent epimerase GB:PROTEIN_ID ACD31315.1 GB:DB_XREF GI:187713018 GB:GENE:GENE wbtF LENGTH 323 SQ:AASEQ MAYDNVKFPHGSFFLVTGGAGFIGSNLCEVLLSKGYRVRCLDDLSNGHYHNVEPFLTNSNYEFIKGDIRDLDTCMKACEGIDYVLHQAAWGSVPRSIEMPLVYEDINVKGTLNMLEAARQNNVKKFVYASSSSVYGDEPNLPKKEGREGNVLSPYAFTKKANEEWARLYTKLYGLDTYGLRYFNVFGRRQDPNGAYAAVIPKFIKQLLNDEAPTINGDGKQSRDFTYIENVIEANLKACLADSKYAGESFNIAYGGREYLIDLYYNLCDALGKKIEPNFGPDRAGDIKHSNADISKARNMLGYNPEYDFELGIKHAVEWYLIN GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 14->321|VIPB_SALTI|4e-78|50.0|308/348| PROS 231->238|PS00867|CPSASE_2|PDOC00676| BL:PDB:NREP 1 BL:PDB:REP 14->322|1sb9A|3e-87|53.1|309/340| RP:PDB:NREP 1 RP:PDB:REP 15->323|1e7rA|2e-45|19.3|290/314| RP:PFM:NREP 1 RP:PFM:REP 15->248|PF01370|2e-41|44.6|224/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 15->253|PF01370|1.5e-62|42.7|234/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 14->321|1sb8A|4e-86|53.2|308/341|c.2.1.2| HM:SCP:REP 13->321|1eq2A_|5e-93|43.2|296/307|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 5507 OP:NHOMOORG 1084 OP:PATTERN 11311-324443355225121342B4447843385338151225836868675133322333453-15 8AC3C22433512126555-55338755555645552334499923222333555214116431866867433333342322836855788426221--54568679A87--------------433554774686CDDAD-11F6B78C9A83333655454455AA9C78544466665454341133423555656A86568699737776456C45233441112119D2333233233333334--116111442331345114335223233323223334333442422432411111111111114223332222322956665666655815543425371-52333449567233312123534A86568-----64CD96537657C33323233326-AAAFAH9B6D327995EJCFIDED54643346AABC44-5555555553455BA6-------------------------1-2-2244314A84487767B6555599BC55554365A7884226548323327463234474325533444435466655A8A85897889878AD9797D7887786D98545414335542422222223343265878545543184556746444546645346--17633------48755766886666674-8867697766865456658756554456566656665686865687377665-644454444546114-6566623335374533332333323333452332144336354856776556563667233322333576564444424256465444433345451-9888AAAA111111113-2----------1-1---13-1-----1133523221684 -122325-431158744242233334411111121111-11111113322465523223333323-11-2-13-211-1112333344-35441514333342558-8F7I9797665332263I9393HD5-4543321523542333152343856A7DB68651334Q6C86A77A*DBB67bRZc2XP7987878 -----------------------4--------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 323 STR:RPRED 100.0 SQ:SECSTR TTccEEEEEcccccEEETTTcHHHHHHHHHHTTcTTEEEEcccTTTccTTcccccHHGGGTTcTTEcHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccTTcccccTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTHHHHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHTHccHHHHHHTccTTcccEHHHHHHHHHHHHTcccEEEEETTccccccccccccHHHHHHTTccccccHHHHHHHHHHHHHHT PSIPRED ccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHcccccEEEEcccccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEccccEEEEEEHHHHHHHHHHHHHHcccccccEEEccccccEEHHHHHHHHHHHHcccccEEEcccccccccEEcccHHHHHHHHcccccccHHHHHHHHHHHHHcc //