[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : wbtM
DDBJ      :wbtM         dTDP-glucose 4,6-dehydratase
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  820/915 : Eukaryota  164/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:349 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   23->349 1kewA PDBj 4e-90 48.6 %
:RPS:PDB   21->349 1e7rA PDBj 9e-43 14.8 %
:RPS:SCOP  21->349 1bxkA  c.2.1.2 * 9e-93 50.3 %
:HMM:SCOP  22->349 1eq2A_ c.2.1.2 * 1.1e-83 35.7 %
:RPS:PFM   23->270 PF01370 * Epimerase 1e-38 41.6 %
:HMM:PFM   23->273 PF01370 * Epimerase 5.7e-69 36.1 233/238  
:BLT:SWISS 24->349 RFBB_XANCP 6e-99 53.1 %
:PROS 168->196|PS00061|ADH_SHORT

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31306.1 GT:GENE wbtM GT:PRODUCT dTDP-glucose 4,6-dehydratase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1600425..1601474) GB:FROM 1600425 GB:TO 1601474 GB:DIRECTION - GB:GENE wbtM GB:PRODUCT dTDP-glucose 4,6-dehydratase GB:PROTEIN_ID ACD31306.1 GB:DB_XREF GI:187713009 GB:GENE:GENE wbtM LENGTH 349 SQ:AASEQ MTSHYRNDDVMRNEKMNYKPKNILVTGAAGFIGSNYVRMMLSRYSDIKIISYDKLTYAGSLDNLKDLNNEQHNHTFIKGDICDEVLVYQTLKEYKIDTIVHFAAESHVDNSIANPKVFLETNVIGTFTLLDCAKRYWLDELGLEETSCRFHHVSTDEVYGTLAKDEPAFTEIKAYEPNSPYSASKAGSDHIARAYHHTYKLPVTISNCSNNYGPYQHREKLIPVVINSCINYKPIPVYGDGSNIRDWLYVEDHCDAIQTIVEKGVVGEVYNIGGINEVDNLTLVKTICKLMDEYKPENAPHSNLITFVEDRKGHDWRYAIDNSKIQNELGWKPSQDFDKMFRQTIEFYL GT:EXON 1|1-349:0| BL:SWS:NREP 1 BL:SWS:REP 24->349|RFBB_XANCP|6e-99|53.1|322/351| PROS 168->196|PS00061|ADH_SHORT|PDOC00060| BL:PDB:NREP 1 BL:PDB:REP 23->349|1kewA|4e-90|48.6|325/361| RP:PDB:NREP 1 RP:PDB:REP 21->349|1e7rA|9e-43|14.8|297/314| RP:PFM:NREP 1 RP:PFM:REP 23->270|PF01370|1e-38|41.6|226/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 23->273|PF01370|5.7e-69|36.1|233/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 21->349|1bxkA|9e-93|50.3|322/341|c.2.1.2| HM:SCP:REP 22->349|1eq2A_|1.1e-83|35.7|297/307|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4061 OP:NHOMOORG 1052 OP:PATTERN 11211-22344345522311122293335522266326152225845959675133322432122--5 37B4522433522223444-432243555552233323352755131-1223553311115311445636222221121121635864AA7518111--43346457A67--------------342324663753BBBBB-11B5A7688892245333243265875955336335474373231121313544444886548489726554444835223431112116B2111111111111113---16111442331335224335223232234322224223442422432411111111111113123332222322847776777666814432314171-5213142A665233212122324883565-----548966326456C33323233336-778C7B7649425775BG6ADAA953732333857844-4444444433444874-----------------------------21232128633655356355556656566643256553223331832231343323235332332233332343575265663996789876868766B5676776A98534112324322332223222243343656435444153355434333345533234--15424------34544454444444453-4544354443443234434534334345255555455355553444244443-422232222333--1-5455512225342222222222222222232221131335221325472223313555133322333243442222225224242222222234341-65557788111111114------------1-1---13-1-----1133421221475 -112123-311146621111-1-212--------------------1111343411112111211-11-2-11-111-11-1112131-21112111111211647-5G662433423112244641548C5-453222-31343123323214333241-157221335F4B538345*B8754OHIO1N966A7878 -----------------------2--------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 349 STR:RPRED 100.0 SQ:SECSTR cccccccTTcccccccTTccEEEEEETTTcHHHHHHHHHHTTcTTEEEEcEccccTTccGGGTTTTTTcTccTTTccTTcHHHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTHTccHHHHHccEEEEEccGGGcccccccGGGTTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTcHHHHHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHccHHHHHHTccTTcccEEEcccccEEHHHHHHHHHHHTcccEEEEETTccccccccccccHHHHHHTTccccccHHHHHHHHHHHHH PSIPRED cccccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccEEEEEcHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHccccEEEccccccccccEEHHHHHHHHHHHHHccccccEEEEcccccEEHHHHHHHHHHHHccccccccccccEEEEcccccccHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHc //