[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : xerC
DDBJ      :xerC         site-specific recombinase
Swiss-Prot:             

Homologs  Archaea  43/68 : Bacteria  826/915 : Eukaryota  2/199 : Viruses  7/175   --->[See Alignment]
a.60.9d.163.1
:292 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->278 1a0pA PDBj 3e-26 33.2 %
:RPS:PDB   5->274 5crxA PDBj 3e-36 11.5 %
:RPS:SCOP  1->284 1p7dA  d.163.1.1 * 2e-28 14.2 %
:HMM:SCOP  2->97 1a0pA1 a.60.9.1 * 1.5e-14 27.1 %
:HMM:SCOP  103->287 4crxA2 d.163.1.1 * 1.2e-48 37.8 %
:RPS:PFM   10->84 PF02899 * Phage_integr_N 5e-09 36.0 %
:RPS:PFM   125->273 PF00589 * Phage_integrase 2e-25 42.2 %
:HMM:PFM   109->276 PF00589 * Phage_integrase 3.5e-41 34.7 167/173  
:HMM:PFM   7->84 PF02899 * Phage_integr_N 9.4e-19 35.9 78/84  
:BLT:SWISS 4->292 XERC_ALCBS 2e-71 46.7 %
:PROS 120->132|PS00018|EF_HAND_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30429.1 GT:GENE xerC GT:PRODUCT site-specific recombinase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(439041..439919) GB:FROM 439041 GB:TO 439919 GB:DIRECTION - GB:GENE xerC GB:PRODUCT site-specific recombinase GB:PROTEIN_ID ACD30429.1 GB:DB_XREF GI:187712132 GB:GENE:GENE xerC LENGTH 292 SQ:AASEQ MTNLEHINNFLDNLLYLKNYSQETINNYQRDLLQLNQALSDKNIISLTHSDILIWIKKLHAQGNSPKTLQRKLSSVRSFFNFLINSEIVSQNPANGIKAPKDSKRLPKVVNTDELAYLLDINPSNDIEARDIACFDLLYSCGIRLSELSSVELKDISISQKNIRVTGKGNKQRIVYFGTKTLSNLSRWLKIRDSLKPSSDYLFISRDGKHLTNRSIQKRLEIFAQKYASRHIHPHMLRHSFASHVLDSSKDLLAVKDLLGHADISSTQIYTHLNFQQLASVFDKAHPRAKKK GT:EXON 1|1-292:0| BL:SWS:NREP 1 BL:SWS:REP 4->292|XERC_ALCBS|2e-71|46.7|289/307| PROS 120->132|PS00018|EF_HAND_1|PDOC00018| BL:PDB:NREP 1 BL:PDB:REP 3->278|1a0pA|3e-26|33.2|256/271| RP:PDB:NREP 1 RP:PDB:REP 5->274|5crxA|3e-36|11.5|270/297| RP:PFM:NREP 2 RP:PFM:REP 10->84|PF02899|5e-09|36.0|75/84|Phage_integr_N| RP:PFM:REP 125->273|PF00589|2e-25|42.2|147/168|Phage_integrase| HM:PFM:NREP 2 HM:PFM:REP 109->276|PF00589|3.5e-41|34.7|167/173|Phage_integrase| HM:PFM:REP 7->84|PF02899|9.4e-19|35.9|78/84|Phage_integr_N| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF02899|IPR004107| GO:PFM GO:0015074|"GO:DNA integration"|PF02899|IPR004107| GO:PFM GO:0003677|"GO:DNA binding"|PF00589|IPR002104| GO:PFM GO:0006310|"GO:DNA recombination"|PF00589|IPR002104| GO:PFM GO:0015074|"GO:DNA integration"|PF00589|IPR002104| RP:SCP:NREP 1 RP:SCP:REP 1->284|1p7dA|2e-28|14.2|274/280|d.163.1.1| HM:SCP:REP 2->97|1a0pA1|1.5e-14|27.1|96/0|a.60.9.1|1/1|lambda integrase-like, N-terminal domain| HM:SCP:REP 103->287|4crxA2|1.2e-48|37.8|185/212|d.163.1.1|1/1|DNA breaking-rejoining enzymes| OP:NHOMO 2444 OP:NHOMOORG 878 OP:PATTERN 11111111111111112---------------111-11-523111111--11--1111111112---- 23B2322222222323222-25223222222293253437224412222221322222222362343---322222233222---111344422222--52835342222222222222222222222322222322111124632716-11------1----2--222A1-------------3211232332353553452564347333322235859B2543222444354724223224442223623433333343332444353422223452121121221322233232331122112211112133111444149434543464446243662322233132185564DA451842222431222D522222222222223222323222222222222-322233222A23242422ED2244223227232222322333333338222232222222222222222222222222222222-22242222262222322222232593222232832395224434333323433222633322-2222222424D332293122525423252235224232322223322211111111112321212412236523244--23443367332423342723332--24232------43442334446465624-522755445255433343236482DH52222232222222223743233322-222222222222--12------1--222213322323222122322323222222232232333323333276722222222222347222222235522222222222222--33442333--------322------1--1--------2---33211111121112A2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------2---------- -------------------------------1---------------------------------------------------1--------------1--------1----------------------1-1---1-------------------------------------- STR:NPRED 290 STR:RPRED 99.3 SQ:SECSTR ##cHHHHHHHHHHHHTGGGccHHHHHHHHHHHHHHHHHHTTcccccccHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHTcccccGGGcHHHHHHHHHHHHHHHTTTccccccccccHHHcccHHHHHHHHHHHHHHHHTccHHHHHHcccTTcccccTTccccccccHHHHHHHHHHHHHTccccTTcccccccccccccccHHHHHHHHHHHHHHHHccccccccccccTTHHHHHHHHHHHHccccHHHHHHTTTcccTTcccccHHHHHHHHcHHHHHGGTHHHHH PSIPRED ccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHcccHHHHcccccEEEEccccccEEEEEccHHHHHHHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHcc //