[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : yhbY
DDBJ      :yhbY         RNA-binding protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  428/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.68.4
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->91 1ln4A PDBj 3e-19 51.7 %
:RPS:SCOP  4->92 1rq8A  d.68.4.1 * 4e-23 39.3 %
:HMM:SCOP  1->94 1ln4A_ d.68.4.1 * 2.2e-23 45.7 %
:RPS:PFM   4->84 PF01985 * CRS1_YhbY 1e-13 50.6 %
:HMM:PFM   1->84 PF01985 * CRS1_YhbY 2.3e-29 48.8 84/84  
:BLT:SWISS 1->91 YHBY_SHIFL 8e-19 51.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31272.1 GT:GENE yhbY GT:PRODUCT RNA-binding protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1552856..1553134) GB:FROM 1552856 GB:TO 1553134 GB:DIRECTION - GB:GENE yhbY GB:PRODUCT RNA-binding protein GB:PROTEIN_ID ACD31272.1 GB:DB_XREF GI:187712975 GB:GENE:GENE yhbY LENGTH 92 SQ:AASEQ MDVKQQQKLKAQAHSLKPVVLMGEKGLTENVILEIDLALASHQLIKVKVGRLPKEEKQQIASEITQATRSELVQIIGNILVLYRRNPNKEKI GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 1->91|YHBY_SHIFL|8e-19|51.7|89/97| BL:PDB:NREP 1 BL:PDB:REP 1->91|1ln4A|3e-19|51.7|89/98| RP:PFM:NREP 1 RP:PFM:REP 4->84|PF01985|1e-13|50.6|81/84|CRS1_YhbY| HM:PFM:NREP 1 HM:PFM:REP 1->84|PF01985|2.3e-29|48.8|84/84|CRS1_YhbY| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF01985|IPR001890| RP:SCP:NREP 1 RP:SCP:REP 4->92|1rq8A|4e-23|39.3|89/96|d.68.4.1| HM:SCP:REP 1->94|1ln4A_|2.2e-23|45.7|94/0|d.68.4.1|1/1|YhbY-like| OP:NHOMO 435 OP:NHOMOORG 435 OP:PATTERN -----------------------------------111-----------11-1--------------- ------------------------------------------------------------------------1111------------------------------------------------------------111-----1-----------------------------------------------11111-1-11111111111--111111111111111111---11111111111111111111------------11------1----1111111111111111111111111111111111111111111-111-1111111111111--1---1-1-11----11----1------1-1-1------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111-11111111111111-11111111111111111-1111----------1-1-11-111111-11--------------------------11111111111111111111111111111111--11111------11111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111---1-----11-11111111111111111111111111111111-11111111111111111111111111-1111111111111111-1-111111111111-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHTTccccEEEcTTcccHHHHHHHHHHHHHHcEEEEEEccccHHHHHHHHHHHHHHHccEEEEEETTEEEEEcccccTTcc DISOP:02AL 92-93| PSIPRED ccHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHHccEEEEEEccEEEEEEcccccccc //