[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98826.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  132/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.66.1
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->61 3bbnD PDBj 7e-05 17.5 %
:RPS:SCOP  4->61 1h3eA2  d.66.1.4 * 3e-06 15.5 %
:HMM:SCOP  1->70 1p9kA_ d.66.1.6 * 2.2e-16 37.1 %
:HMM:PFM   49->70 PF08142 * AARP2CN 1.8e-05 54.5 22/84  
:BLT:SWISS 1->69 YAAA_BACSU 2e-20 58.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98826.1 GT:GENE ABD98826.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 3088..3309 GB:FROM 3088 GB:TO 3309 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0011 [S] Uncharacterized conserved protein GB:PROTEIN_ID ABD98826.1 GB:DB_XREF GI:90820187 LENGTH 73 SQ:AASEQ MAQKVKLKTDYITLGQLLKIVDIISSGGQAKWFLQENDVLINGELDNRRGRKLYPNDLVEIPEYGKFMMEADK GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 1->69|YAAA_BACSU|2e-20|58.0|69/71| RP:PDB:NREP 1 RP:PDB:REP 5->61|3bbnD|7e-05|17.5|57/199| HM:PFM:NREP 1 HM:PFM:REP 49->70|PF08142|1.8e-05|54.5|22/84|AARP2CN| RP:SCP:NREP 1 RP:SCP:REP 4->61|1h3eA2|3e-06|15.5|58/81|d.66.1.4| HM:SCP:REP 1->70|1p9kA_|2.2e-16|37.1|70/79|d.66.1.6|1/1|Alpha-L RNA-binding motif| OP:NHOMO 132 OP:NHOMOORG 132 OP:PATTERN -------------------------------------------------------------------- ---------------------1------------------------------------------------------------1--------------------------------------------------------------------------------------1-------------------1-111111111111111111111111111111111111111111-111111111111-11-11111111111-11111111111111111111-1-11-------------1-1111----111111111111--1--------------1--1-------1-----------111-111--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 89.0 SQ:SECSTR ###HTTTHHHHccTTTTTTTTTcccccHHHHHHHHTTcEEETTEEcccTTccccTTEEEEEcGGGccc##### DISOP:02AL 1-2,72-74| PSIPRED ccEEEEEccEEEEHHHHHHHcccccccHHHHHHHHcccEEEccEEEEccccEEccccEEEEccEEEEEEEEcc //