[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98840.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.142.1
:416 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   81->334 3e5nA PDBj 4e-16 13.6 %
:RPS:SCOP  120->323 1vkzA3  d.142.1.2 * 3e-18 15.5 %
:HMM:SCOP  120->330 1e4eA2 d.142.1.1 * 1.3e-25 19.3 %
:RPS:PFM   133->304 PF07478 * Dala_Dala_lig_C 2e-06 24.8 %
:HMM:PFM   262->323 PF02786 * CPSase_L_D2 0.00017 17.7 62/211  
:HMM:PFM   129->224 PF07478 * Dala_Dala_lig_C 0.00017 20.9 86/203  
:BLT:SWISS 46->323 CARB_LACLA 1e-07 26.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98840.1 GT:GENE ABD98840.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 21315..22565 GB:FROM 21315 GB:TO 22565 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG3919 [R] Predicted ATP-grasp enzyme GB:PROTEIN_ID ABD98840.1 GB:DB_XREF GI:90820201 LENGTH 416 SQ:AASEQ MSAPAFTPILLGSDFNVYGMARSFYEIYHKPVKAFAEIELAPTRFTKIVDLELIDGFSEDPVWINEMRKIKKRYADHEEPVILIGCGDGYAELIAKHKDELSDVFICPYVDYDLLKHLNNKERFYEMCDKYDLPYPKTKIITKADHDSGDKIEQPFQYPVALKPANSVEWLDVHFEGRKKAFRIKDREEFDYVLKQAYANGYKSDFILQDFIPGDDSHMRVLNAYVDKDHKVKMMCMGHPLLEDPAPSAIGNYVAILPDFNQDIYDRIKNFLEAINYTGYANFDMKYDTRDNTYKLFEINLRQGRSSFFVTLDGYNLADWVVKDYVKDSLKDQETVYGNKDEEQHALWLGVPAKVFKKYAKDNEDKQKALELIKAGRYGTTFEYSKDMNIRRWLLIKWMNHNYVKNFNRYFKENKG GT:EXON 1|1-416:0| BL:SWS:NREP 1 BL:SWS:REP 46->323|CARB_LACLA|1e-07|26.0|258/1064| RP:PDB:NREP 1 RP:PDB:REP 81->334|3e5nA|4e-16|13.6|228/340| RP:PFM:NREP 1 RP:PFM:REP 133->304|PF07478|2e-06|24.8|161/199|Dala_Dala_lig_C| HM:PFM:NREP 2 HM:PFM:REP 262->323|PF02786|0.00017|17.7|62/211|CPSase_L_D2| HM:PFM:REP 129->224|PF07478|0.00017|20.9|86/203|Dala_Dala_lig_C| GO:PFM:NREP 2 GO:PFM GO:0008716|"GO:D-alanine-D-alanine ligase activity"|PF07478|IPR011095| GO:PFM GO:0009252|"GO:peptidoglycan biosynthetic process"|PF07478|IPR011095| RP:SCP:NREP 1 RP:SCP:REP 120->323|1vkzA3|3e-18|15.5|194/220|d.142.1.2| HM:SCP:REP 120->330|1e4eA2|1.3e-25|19.3|192/0|d.142.1.1|1/1|Glutathione synthetase ATP-binding domain-like| OP:NHOMO 46 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------------1211-----------------11---1--------11---------------------------------------------------------------------------------------1-----------------------1---------------------------3--------------------------------1121121111--1111111---111----------------------------------------------1-----------------------1-------------1----------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---------------------------------1--------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 390 STR:RPRED 93.8 SQ:SECSTR #########EcccHHHHHHHHHHHHHHHEcTTcccccHHHHHHHHTTccHHHHHHHHHTTccTTcTTHHHHHHHHHTTccEEEEEEccHHHHccHHHHHHHHTTcccccccHHHHHHHHcHHHHHHHHHHTTcccccEEEEEHHHHTTccHHHHHHcccEEEEEcccHHHHcccccccTTcEEEccGGGHHHHHHHHTTcETccEEEEEEccccEETEEEEEEEEEETTTTEEEEEEcccccEEEEEEEEcccEEccccccHHHHHHHHHHHHHHTcccEEEEEEEEcHTTccEEEEEEEccccccTTcHHHTTccHHHHHHHHHHHHHHHHHHTcccccEEEEEEEEcccTTTTTccccEEcccEEccccTTEEccccccccccEEcTTcccEEEEEE################# DISOP:02AL 1-3,413-417| PSIPRED ccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEEEccccccccccccccEEccccccccEEHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHcEEEEEcccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccccccEEEEccHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEEEEccccEEEEEcccEEEEccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEEccccccccHHHHHHHccHHHHHHHHHHcccccccccccccccccccEEEEccccccHHHcccccHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccc //