[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98853.1
DDBJ      :             DNA-damage-inducible protein J
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->72 PF04221 * RelB 1e-04 39.4 %
:HMM:PFM   8->64 PF04221 * RelB 1.6e-10 31.5 54/83  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98853.1 GT:GENE ABD98853.1 GT:PRODUCT DNA-damage-inducible protein J GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 35796..36092 GB:FROM 35796 GB:TO 36092 GB:DIRECTION + GB:PRODUCT DNA-damage-inducible protein J GB:PROTEIN_ID ABD98853.1 GB:DB_XREF GI:90820214 LENGTH 98 SQ:AASEQ MTKTVTTTIRLDEELKKELTHDLDIMGLNINAYFTMAAKQLVLKKKIPFEISTSSNDISNETTRKAMILAEAKELGLIPDDSPRFSNVDDMMEFLDGE GT:EXON 1|1-98:0| RP:PFM:NREP 1 RP:PFM:REP 4->72|PF04221|1e-04|39.4|66/81|RelB| HM:PFM:NREP 1 HM:PFM:REP 8->64|PF04221|1.6e-10|31.5|54/83|RelB| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,98-99| PSIPRED ccEEEEEEEEEcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccc //