[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98866.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->121 3bjaA PDBj 8e-05 14.2 %
:RPS:SCOP  8->121 2fbiA1  a.4.5.28 * 1e-07 19.3 %
:HMM:SCOP  3->115 1fzpB_ a.4.5.28 * 2.1e-13 29.1 %
:HMM:PFM   31->91 PF01047 * MarR 1.5e-09 32.8 58/59  
:HMM:PFM   63->120 PF07705 * CARDB 6.5e-05 24.1 54/101  
:BLT:SWISS 6->117 YUSO_BACSU 1e-04 27.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98866.1 GT:GENE ABD98866.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 52274..52666 GB:FROM 52274 GB:TO 52666 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:NOTE COG1522 [K] Transcriptional regulators GB:PROTEIN_ID ABD98866.1 GB:DB_XREF GI:90820227 LENGTH 130 SQ:AASEQ MLENWLELQKFRKQVNTELERSLSQMVPAVTVNEFYVLHFLEQNAGHDLRVSDLSQKLDLSLSATSRMLVRFEQTCNVITRNQGQEDKRSVRINLTAEGENVLSEAKQRIDAVLSKYEEKLVNFGGIKND GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 6->117|YUSO_BACSU|1e-04|27.1|107/155| SEG 52->63|sdlsqkldlsls| RP:PDB:NREP 1 RP:PDB:REP 5->121|3bjaA|8e-05|14.2|106/132| HM:PFM:NREP 2 HM:PFM:REP 31->91|PF01047|1.5e-09|32.8|58/59|MarR| HM:PFM:REP 63->120|PF07705|6.5e-05|24.1|54/101|CARDB| RP:SCP:NREP 1 RP:SCP:REP 8->121|2fbiA1|1e-07|19.3|109/136|a.4.5.28| HM:SCP:REP 3->115|1fzpB_|2.1e-13|29.1|110/115|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1---1------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 88.5 SQ:SECSTR ####HHHHHHHHHHHHHHHHHHTGGG##TccHHHHHHHHHHHHcccEEHHHHHHcTTHHHHccccTTHHHHHHHTTcEEEEccTTccTTcEEEEEcHHHHHHHHHHHHHHHHHHHHHHccc######### DISOP:02AL 129-131| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccHHHccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //