[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98872.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->54 PF05101 * VirB3 0.00055 28.1 32/89  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98872.1 GT:GENE ABD98872.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(60583..60777) GB:FROM 60583 GB:TO 60777 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD98872.1 GB:DB_XREF GI:90820233 LENGTH 64 SQ:AASEQ MLVDSRLFDWSFFKKFFQNITSKFSYRFIIPLFQIFRKKFLSNYDTQFDKIYARIGAINRVGDN GT:EXON 1|1-64:0| HM:PFM:NREP 1 HM:PFM:REP 22->54|PF05101|0.00055|28.1|32/89|VirB3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,62-65| PSIPRED ccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //