[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98875.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->90 1b0nA PDBj 5e-05 22.5 %
:RPS:SCOP  14->75 1q05A  a.6.1.3 * 5e-06 24.2 %
:HMM:PFM   6->39 PF01381 * HTH_3 1.9e-07 27.3 33/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98875.1 GT:GENE ABD98875.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 63881..64300 GB:FROM 63881 GB:TO 64300 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD98875.1 GB:DB_XREF GI:90820236 LENGTH 139 SQ:AASEQ MISEVEKYMKSKGISISDVSKASGISVSTLSNAFNKPVTTWSIRILNGLAAATFDDPAKVLAEIQTRPFKYIVDEEKQTIQGFHIEDPQLFWKIESAVHSSVMEGWQPTKADIMDAYRVATEYQPKIESDFKRIFGEKS GT:EXON 1|1-139:0| RP:PDB:NREP 1 RP:PDB:REP 1->90|1b0nA|5e-05|22.5|89/103| HM:PFM:NREP 1 HM:PFM:REP 6->39|PF01381|1.9e-07|27.3|33/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 14->75|1q05A|5e-06|24.2|62/122|a.6.1.3| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--11---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 92.8 SQ:SECSTR ccHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTccccccHHHHHHHHHHcHTccHHHHHccTTccccHHHHHHHHHHHHccccHHHHcTHHHHHHH#HHHHHHHHHHHHHHHHHHHTTcccTTccHH######### DISOP:02AL 1-2,23-24,138-140| PSIPRED cHHHHHHHHHHccccHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHcccEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHcccc //