[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98879.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->69 PF05791 * Bacillus_HBL 0.00047 31.8 44/184  
:HMM:PFM   5->38 PF01381 * HTH_3 0.00064 15.2 33/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98879.1 GT:GENE ABD98879.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 67454..67684 GB:FROM 67454 GB:TO 67684 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD98879.1 GB:DB_XREF GI:90820240 LENGTH 76 SQ:AASEQ MKIDIKAYLNSKELTIYQVSKYSGYGYTTLHKSFNKKQTSATSLNLRDLDALAQSQNKAMWQVLKELEEHYLSDDN GT:EXON 1|1-76:0| HM:PFM:NREP 2 HM:PFM:REP 25->69|PF05791|0.00047|31.8|44/184|Bacillus_HBL| HM:PFM:REP 5->38|PF01381|0.00064|15.2|33/55|HTH_3| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11------1---1-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,73-77| PSIPRED cEEEEEEEEEcccEEEEEEEccccccEEEHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //