[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98893.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98893.1 GT:GENE ABD98893.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(90207..90479) GB:FROM 90207 GB:TO 90479 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD98893.1 GB:DB_XREF GI:90820254 LENGTH 90 SQ:AASEQ MNEKNLEVKINENDIVPAQVIKVNNKTITLKTEDNEIITVDRPKSTIKDKLFLKTMIDILRSGIWIPVNKKLKQLLRYDWFDSLEEYQFL GT:EXON 1|1-90:0| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHcccccEEEEEEEEcccEEEEEEccccEEEEEccHHHHccHHHHHHHHHHHHcccEEEEHHHHHHHHHccHHHHHHHHccc //