[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98902.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  97/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:228 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  10->65 1bvyF  c.23.5.1 * 7e-04 25.0 %
:RPS:PFM   2->215 PF04474 * DUF554 2e-18 32.4 %
:HMM:PFM   1->220 PF04474 * DUF554 1e-63 44.0 216/226  
:BLT:SWISS 1->205 YDFK_BACSU 5e-51 58.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98902.1 GT:GENE ABD98902.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(100444..101130) GB:FROM 100444 GB:TO 101130 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG1811 [R] Uncharacterized membrane protein, possible Na+ channel or pump GB:PROTEIN_ID ABD98902.1 GB:DB_XREF GI:90820263 LENGTH 228 SQ:AASEQ MIGTFFNVSTILIGSLLGNYFKKSFADKYQEILMQAMGLAATCLGMQAVLQNLPKSKLPILFILSLAIGGVLGVKFDLATRFSNSVKKFSNSKSSEGLSTAILLYCMGTLSILGPVEAALHHNYTYLFTNGILDGITSIILASTFGLIIMLAALVLFFWQGSFYLIAFLLQSNVNPDFLHELSIVGGVLILASGLSILGIKKFETMNLLPSLLVSGILFFILHYIGTI GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 1->205|YDFK_BACSU|5e-51|58.0|205/100| TM:NTM 8 TM:REGION 1->21| TM:REGION 30->52| TM:REGION 57->79| TM:REGION 97->119| TM:REGION 125->147| TM:REGION 152->174| TM:REGION 179->200| TM:REGION 206->228| SEG 82->95|fsnsvkkfsnskss| SEG 184->200|ivggvlilasglsilgi| RP:PFM:NREP 1 RP:PFM:REP 2->215|PF04474|2e-18|32.4|210/226|DUF554| HM:PFM:NREP 1 HM:PFM:REP 1->220|PF04474|1e-63|44.0|216/226|DUF554| RP:SCP:NREP 1 RP:SCP:REP 10->65|1bvyF|7e-04|25.0|52/152|c.23.5.1| OP:NHOMO 102 OP:NHOMOORG 98 OP:PATTERN -----------------------1-------------------------------------------- ------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------11-11-11111111-111111-1---111111121111111111-------------------------11-2---11-----1-------111-----------------------------------------111-1-------1-1-111-----1---1--1122--11111111111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111-11111-1-1--1---------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1111-111-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 87-96| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHcHHHHHHHHHHHHHHHHHcc //