[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98903.1
DDBJ      :             Putative sugar-binding protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:431 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->174 1eu8A PDBj 6e-06 24.2 %
:RPS:PDB   45->431 1a7lA PDBj 3e-25 14.5 %
:RPS:SCOP  41->429 1eljA  c.94.1.1 * 2e-27 15.2 %
:HMM:SCOP  41->429 1eljA_ c.94.1.1 * 1.3e-47 23.6 %
:HMM:PFM   49->334 PF01547 * SBP_bac_1 8.8e-26 20.7 271/314  
:BLT:SWISS 44->367 YURO_BACSU 4e-09 24.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98903.1 GT:GENE ABD98903.1 GT:PRODUCT Putative sugar-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(101288..102583) GB:FROM 101288 GB:TO 102583 GB:DIRECTION - GB:PRODUCT Putative sugar-binding protein GB:NOTE COG1653 [G] ABC-type sugar transport system, periplasmic component GB:PROTEIN_ID ABD98903.1 GB:DB_XREF GI:90820264 LENGTH 431 SQ:AASEQ MKKRYIILSVLLMILVIISEIFIYQKKQKVITIGIYSDSSWDVPNDNEYKFIDYVVKKFEKENPNVKVKYESGINKNDYLEWLSQKIVDNKAPDVFIVPSEQFGFLSSLGTMRNLNYFMDLSGLNTDDYYPTNLKAGMSAGKQYALPLESNPMMMCVNTDLLKKEHITIPKSGWTLNDFYRICRQVTKDTNHDGVVDQFGYADYSWKDAAQAYNAKLFNSQGTASYFNSDKVRQALTMMEKLYNLQKDYKVTADDFDKGKVAFLPMTLAQYRTYESYPYRVSRYSSFSWTCIRMPGATPDINSTYVNTSMVAMSSQSTHPLLSWKLVKFLSNNGDVQQKLFTYSQGASVLKSVMKSKDITENLQKENNADNALTEEKFVSIMAKSQKYPEFKNYNNVMQTADYLINNALENGNVEVQLSNIQNQIQEELAK GT:EXON 1|1-431:0| BL:SWS:NREP 1 BL:SWS:REP 44->367|YURO_BACSU|4e-09|24.1|295/422| TM:NTM 1 TM:REGION 5->25| SEG 6->21|iilsvllmilviisei| BL:PDB:NREP 1 BL:PDB:REP 47->174|1eu8A|6e-06|24.2|128/407| RP:PDB:NREP 1 RP:PDB:REP 45->431|1a7lA|3e-25|14.5|358/380| HM:PFM:NREP 1 HM:PFM:REP 49->334|PF01547|8.8e-26|20.7|271/314|SBP_bac_1| RP:SCP:NREP 1 RP:SCP:REP 41->429|1eljA|2e-27|15.2|362/380|c.94.1.1| HM:SCP:REP 41->429|1eljA_|1.3e-47|23.6|356/380|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 92 OP:NHOMOORG 73 OP:PATTERN ----------------1---------------------------------------1----------- ----------------------------------------------1-1-----2-----1---1--1-------1------------------------------------------------------------222-1--------1-----------------11-------------------1--2-----------------2111------------21221123------------------------------1-------1-------121----111------------------------1-1---1111-111-111111--1--2---1--2----------11-------1112--1--------------------------------------------------11--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------3-11-2------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 407 STR:RPRED 94.4 SQ:SECSTR ########################cccccEEEEEEcccccHHHHTTccHHHHHHHHHHHHHHHHcccEEEEccEccTTHHHHHHHHGGGTccccEEEEEGGGHHHHHHTTccccccccHcccTHHHTTccHHHHGGGEETTEEccEEEEEEccEEEEETTTccccccccTHHHHHHHTTTccccccccccHHHHHHHHHHTHHHHHHHTcEEEcccccccccccEEcccHHHHHHHHHHHHHHcTHTTcccTTccHHHHHHHHHTTcccEEEEcGGGHHHHHHHHTccEEEEcccccTTcccccEEEEEEEEEcTTcTTHHHHHHHHHHTTccHHHHHHHHHHHccccEEccHHHHHHHTTcHHHHHHHHHHHHcEEccccHHHcEEccccTTHHHHHHHHHHHHHHHHTTccHHHHHHHHHccHHHHccc DISOP:02AL 1-2| PSIPRED ccccEEHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccccccHHHcccccccHHHccHHHHHHcccccEEEEEEEEcccEEEEEEHHHHHHcccccccccccHHHHHHHHHHHHHccccccEEccccccHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHHHHHHccccccHHHHHHHcccEEEEcccccccccccccHHHHHHcccccEEEEEccccccccccEEEEEEEEEEEcccccHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHcHHHHHHHHcccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcc //