[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98915.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->135 3fj2A PDBj 2e-06 26.2 %
:RPS:PDB   76->148 2bbeA PDBj 6e-04 8.2 %
:HMM:PFM   112->142 PF03992 * ABM 3e-05 20.7 29/78  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98915.1 GT:GENE ABD98915.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 114069..114566 GB:FROM 114069 GB:TO 114566 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABD98915.1 GB:DB_XREF GI:90820276 LENGTH 165 SQ:AASEQ MLKNLNLTFGPEKQLQEIIENNKDRQMVLLESVTDSEKFALLDISNEESIFHSQLDYRIYHTINLKEWNGFFEFRYVTLDTEQQKIFNAHLGKWDDPFNRPVGLKSTLVGHDERKDYEFLMINIWEDQEDYVEWENESDNEFREFGHGGNAKALVAQYKLVKNKE GT:EXON 1|1-165:0| BL:PDB:NREP 1 BL:PDB:REP 3->135|3fj2A|2e-06|26.2|126/165| RP:PDB:NREP 1 RP:PDB:REP 76->148|2bbeA|6e-04|8.2|73/103| HM:PFM:NREP 1 HM:PFM:REP 112->142|PF03992|3e-05|20.7|29/78|ABM| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11--11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 86.7 SQ:SECSTR ##EEEEEEEEcHHHHHHHHHHTccccEEEEEccccE###EEEEEEEcccTTcccEEEEEEEEEEccccccEEEEEEEEEcTTcHHHHHHHHHTTHHHHHTcTTEEEEEEEEccccTTEEEEEEEEccHHHHHHHHTHHHHHHHHHTHH################# DISOP:02AL 1-2,163-166| PSIPRED cccEEEEccccHHHHHHHHHHcccccEEEEEEccccEEEEEEEcccccEEEccccEEEEEEEccccccccEEEEEEEEccHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccEEEEEEEcccHHHHHHccccHHHHHHHcccccHHHEEEEEEEEcccc //