[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98917.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->65 3isqA PDBj 4e-04 35.5 %
:HMM:PFM   10->84 PF10394 * Hat1_N 0.00069 29.2 72/161  
:BLT:SWISS 15->107 DYHC_DICDI 4e-05 36.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98917.1 GT:GENE ABD98917.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 118318..118758 GB:FROM 118318 GB:TO 118758 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD98917.1 GB:DB_XREF GI:90820278 LENGTH 146 SQ:AASEQ MQLHLSERALKILAKEKIKDAKVTDKELVDVYEEILSVVNKHFELYDISKFRQKLNEGLELFKELPIYNVYESNKIKQVGKFEVLNRILIGLHANAMRTDLKVLGIKVNLGQMQVKGGIKLSPDAKLIYQSPTGIFSRAVRVKDLG GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 15->107|DYHC_DICDI|4e-05|36.0|86/4730| BL:PDB:NREP 1 BL:PDB:REP 4->65|3isqA|4e-04|35.5|62/376| HM:PFM:NREP 1 HM:PFM:REP 10->84|PF10394|0.00069|29.2|72/161|Hat1_N| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 42.5 SQ:SECSTR ###HHHHTTcccccHHHHTTccccccccHHHHHHHTcEEEEccccEEEEEEccccccccccEEEE################################################################################# DISOP:02AL 1-6,146-147| PSIPRED ccEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccHHHHHHHHHHHHHHHHHHcccHHHccEEEEEEEEEEEEEEEEccEEEcccccEEEEccccHHHHEEEEEccc //