[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98921.1
DDBJ      :             CRISPR-associated protein, SAG0897 family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.93.1
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   93->196 1dcnA PDBj 4e-04 11.7 %
:RPS:SCOP  169->222 1cqeA1  a.93.1.2 * 3e-04 22.6 %
:RPS:PFM   100->219 PF09711 * Cas_Csn2 7e-06 31.9 %
:HMM:PFM   83->220 PF09711 * Cas_Csn2 1e-06 22.9 131/188  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98921.1 GT:GENE ABD98921.1 GT:PRODUCT CRISPR-associated protein, SAG0897 family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 120137..120808 GB:FROM 120137 GB:TO 120808 GB:DIRECTION + GB:PRODUCT CRISPR-associated protein, SAG0897 family GB:PROTEIN_ID ABD98921.1 GB:DB_XREF GI:90820282 LENGTH 223 SQ:AASEQ MKLYYTGHKNIEINAGKITVLGTNNVDVYKEFIDTFLNGYGSNIQLSDDKYNRKDISTSIDWDGDVMLTDRISKKYMNVLIKKIIEDITDDERQAILKSVNGLYDHIREVLYKIDIPLQVDYDNDLTRLFKYCQVHTEALLWKNAYDRISSDVKLHVELDRKRIIGLTNVAHYLTKEEFQELVNLVKATNASMFIIEFTEKIGQRFFENCDNYYIDEDYIDWY GT:EXON 1|1-223:0| SEG 81->92|ikkiieditdde| RP:PDB:NREP 1 RP:PDB:REP 93->196|1dcnA|4e-04|11.7|103/424| RP:PFM:NREP 1 RP:PFM:REP 100->219|PF09711|7e-06|31.9|113/183|Cas_Csn2| HM:PFM:NREP 1 HM:PFM:REP 83->220|PF09711|1e-06|22.9|131/188|Cas_Csn2| RP:SCP:NREP 1 RP:SCP:REP 169->222|1cqeA1|3e-04|22.6|53/510|a.93.1.2| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 46.2 SQ:SECSTR ############################################################################################HHHHHHHHHHHHHHHHHHHHHcEEcHHHTccGGGGHHHHHHHHHTTTccHHHHHHHHHHHHH#HHHTTTccTTTccHTTcTTccGGGGGTccHHHHHTTcccTT########################### DISOP:02AL 1-1| PSIPRED cEEEcccccEEEEcccEEEEEEEccHHHHHHHHHHHHHcccccEEEcccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHHcccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEEEEEHHHHHcHHHHHHHHHHHHHHcccEEEEEEEcccccHHHcccccEEEccHHHccc //