[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98924.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:321 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 34->165 SHE9_PICGU 2e-05 22.7 %
:BLT:SWISS 143->267 PPAN_DICDI 3e-04 24.2 %
:TM
:REPEAT 3|183->211|221->249|260->288
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98924.1 GT:GENE ABD98924.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 123872..124837 GB:FROM 123872 GB:TO 124837 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD98924.1 GB:DB_XREF GI:90820285 LENGTH 321 SQ:AASEQ MKKTIISGFIISIIGAILLAIGLGLKGNKSIVFEDLKPVIADSTKVTQAHTYKDINKLDIDVKDVNVEFREGKNYSVRYEGAKSSSPTVKKSGNQLQIKGRLSSHSIRFNGMSMYDDYYRNSDRNKMIITLPKDSKLDELNLKLSDSLLSQVNMTGIEADRVKASIHDTKLDLRDANFGNVELSAGDSDISMTNTVLSNGKLDLNDTDVRLDGGSLMQVAMNITEGDVDYNNLSIQGGNLRNNDGDIKMSNTQIQGGYKIDDTDGDILVSRVTVDGYRVQSNDGDVRLFEQTTSNGNVLEKNSNSDNVLDIISNDGDITVN GT:EXON 1|1-321:0| BL:SWS:NREP 2 BL:SWS:REP 34->165|SHE9_PICGU|2e-05|22.7|132/440| BL:SWS:REP 143->267|PPAN_DICDI|3e-04|24.2|124/426| TM:NTM 1 TM:REGION 4->25| NREPEAT 1 REPEAT 3|183->211|221->249|260->288| SEG 5->25|iisgfiisiigaillaiglgl| OP:NHOMO 17 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------11-----2231111---1--------------1-----------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,293-293,297-298| PSIPRED cccEEEEHHHHHHHHHHHHHHccccccccEEEEEcccEEEEEHHHEccEEccccccEEEEEEcccEEEEEccccEEEEEEcccccccccEEEccEEEEEEEcccccccEEEccccccccccccccEEEEEcccccEEEEEEEEEccccccEEEEccEEEEEEEEEcccEEEEEccEEEcEEEEEcccEEEEEcccEEEEEEEEccccEEEEEccccccEEEEEcccEEEEcccccccEEEEccccEEEEccccccccEEEEEEEEEEEEEcccccEEEEEccccEEEEccccccccccEEEcccccEEEEEEcccccEEEc //