[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98926.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.29.8
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->102 2bl8A PDBj 8e-07 31.9 %
:RPS:PDB   10->83 2bl8B PDBj 1e-04 29.7 %
:HMM:SCOP  5->81 2bl7A1 a.29.8.2 * 8.8e-10 29.9 %
:RPS:PFM   5->79 PF08951 * EntA_Immun 8e-04 29.3 %
:HMM:PFM   6->79 PF08951 * EntA_Immun 1e-18 29.7 74/75  
:BLT:SWISS 19->102 MESI_LEUME 5e-07 27.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98926.1 GT:GENE ABD98926.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 125426..125737 GB:FROM 125426 GB:TO 125737 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD98926.1 GB:DB_XREF GI:90820287 LENGTH 103 SQ:AASEQ MEKVQELQRLVVELYDSFENDNRKGVEEIRQVLANVNEKYKTSSHPLAWTGRLVLYLQVNAVKKDLYLTSEQKDIIKELARIGKRTNLNYVYLSPVDDAKQFV GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 19->102|MESI_LEUME|5e-07|27.4|84/113| BL:PDB:NREP 1 BL:PDB:REP 8->102|2bl8A|8e-07|31.9|91/93| RP:PDB:NREP 1 RP:PDB:REP 10->83|2bl8B|1e-04|29.7|74/81| RP:PFM:NREP 1 RP:PFM:REP 5->79|PF08951|8e-04|29.3|75/75|EntA_Immun| HM:PFM:NREP 1 HM:PFM:REP 6->79|PF08951|1e-18|29.7|74/75|EntA_Immun| HM:SCP:REP 5->81|2bl7A1|8.8e-10|29.9|77/0|a.29.8.2|1/1|Bacteriocin immunity protein-like| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------111-------1------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 92.2 SQ:SECSTR #######HHHHHHHHHHHTTcccGGGHHHHHHHHHHHHHHTcGGGcHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHcccTTTcccccccTTcGGGc# DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccEEEcccccHHHHHc //