[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98930.1
DDBJ      :             Spermidine/putrescine transport ATP-binding protein potA
Swiss-Prot:POTA_LACS1   RecName: Full=Spermidine/putrescine import ATP-binding protein potA;         EC=3.6.3.31;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  198/199 : Viruses  0/175   --->[See Alignment]
b.40.6c.37.1
:362 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   12->352 2yyzA PDBj 8e-67 42.2 %
:RPS:PDB   1->237 3dmdC PDBj 1e-55 12.2 %
:RPS:SCOP  5->240 1b0uA  c.37.1.12 * 1e-54 30.8 %
:RPS:SCOP  241->345 3d31A1  b.40.6.3 * 8e-14 22.1 %
:HMM:SCOP  3->237 1g2912 c.37.1.12 * 2.2e-75 44.0 %
:HMM:SCOP  239->344 1oxsC1 b.40.6.3 * 7.7e-15 28.0 %
:RPS:PFM   46->165 PF00005 * ABC_tran 5e-27 52.1 %
:HMM:PFM   46->164 PF00005 * ABC_tran 6.9e-29 37.7 114/118  
:HMM:PFM   275->344 PF08402 * TOBE_2 1.2e-11 30.9 68/75  
:HMM:PFM   18->63 PF03193 * DUF258 9.5e-07 26.7 45/161  
:BLT:SWISS 1->362 POTA_LACS1 0.0 100.0 %
:PROS 137->151|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98930.1 GT:GENE ABD98930.1 GT:PRODUCT Spermidine/putrescine transport ATP-binding protein potA GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 130357..131445 GB:FROM 130357 GB:TO 131445 GB:DIRECTION + GB:PRODUCT Spermidine/putrescine transport ATP-binding protein potA GB:NOTE COG3842 [E] ABC-type spermidine/putrescine transport systems, ATPase components GB:PROTEIN_ID ABD98930.1 GB:DB_XREF GI:90820291 LENGTH 362 SQ:AASEQ MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATSGDVYFDGKRINDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEALRMVRLDGYEDRAISEMSGGQRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELRSLQKKLGITFIFITHDQEEALAMSDEIFVLNNGNIVQSGTPVDIYDEPINHYVADFIGESNIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPEDLVLTSPEKGQLKVKVDTQLFRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPEDIHVMRFNESEEDFDARLDSYND GT:EXON 1|1-362:0| SW:ID POTA_LACS1 SW:DE RecName: Full=Spermidine/putrescine import ATP-binding protein potA; EC=3.6.3.31; SW:GN Name=potA; OrderedLocusNames=LSL_0113; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase; Membrane;Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->362|POTA_LACS1|0.0|100.0|362/362| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 137->151|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 12->352|2yyzA|8e-67|42.2|332/358| RP:PDB:NREP 1 RP:PDB:REP 1->237|3dmdC|1e-55|12.2|221/318| RP:PFM:NREP 1 RP:PFM:REP 46->165|PF00005|5e-27|52.1|119/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 46->164|PF00005|6.9e-29|37.7|114/118|ABC_tran| HM:PFM:REP 275->344|PF08402|1.2e-11|30.9|68/75|TOBE_2| HM:PFM:REP 18->63|PF03193|9.5e-07|26.7|45/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 5->240|1b0uA|1e-54|30.8|234/258|c.37.1.12| RP:SCP:REP 241->345|3d31A1|8e-14|22.1|104/119|b.40.6.3| HM:SCP:REP 3->237|1g2912|2.2e-75|44.0|234/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 239->344|1oxsC1|7.7e-15|28.0|100/0|b.40.6.3|1/1|MOP-like| OP:NHOMO 58995 OP:NHOMOORG 1174 OP:PATTERN aaLDUPMOcbbWbWdTqMYVSUTb*QVosdlZLEFEGFJHJHFYcVcsOS**oATkUYcQXOLIe2AA ae*T*knlvvzfjYcZdSR-RpDDd*SSSSSS*vww****b*g****j*wnW***TVpGG***p******iigff*hgoU*qwCCEBCabXP8QGKN--JKZOOOoTdWXABBBBBBEEDDDDDKWTOVdRQZYgXx****ONN*d*x**ssriobdTRSORMooft***iOVKPOPNUNPKOtgjVT*rBek*************************kv***r*********cqrtstqoqsqqqrqelggj*qim**nVmet**VV**jbVfqsporwx***x******zzyu**x*zghgffhijkjifg**ylklxwzuz***********o*q****fppm**o***v*WO***peijsUdpkxxRljhQhbWWPOPOLQib***iZz****************-y**ro*x***XG**************NNS**********YXYYYYYY*ioOXph*88688888667ACADEBDDCCCBBB97B7NGHLGJ************************y********CQ****y*ty******ivtTYPXrhMNNMPNMVVXexph**Wmd*tYu*jhwOiifaYhpaghhhk**b*RPOTIPPPRPKCEEFEEFEEKYHJMVU*w*U*amNYS*WbefbTbhbZZbZdhfdjd5-GNbVN331544****e************-************************xtnyvswvyxyyxtwywwu**x*****b6************55MKGJFGHQRTRVQ*w*jjieigOTXTSZUZlPRVVRJXKTX*n*************s***HGGEGIGGGQnvt***********ZZXTUUTTVWIHHHA8TXWWOPQQBCABAAAB*FgFEEEJ-HHHFNJGUTPDJSFLKBBCit*dcz**zxGnS 4478zsQ1qPCFepWPNPKPRWRcNYUMNHJHJTSQGQLNKMLIHGPPPZXUlaNOTGIKKKGDI9GB3DE7FHLEH3GJEEEBHL8B-RjHNLOPFDGOI8KSSSBa*y*hpgzlqSLLIQgR**M*N**w4*a*PQKHoIP*iITNMIiHG*LfUV*Qw*X*YlL*mu*orxYKUMP*NQMUW****M**WU****j ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,359-363| PSIPRED ccccEEEEEEEEEEcccccEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHcccccEEEEEEEcccEEEEcccEEEEcccccccccEEEEEEcccEEEEccccccEEEEEEEEEEEcccEEEEEEEEccccEEEEEcccccccccEEEEEEcHHHEEEEcccccccHHHHHHccccc //