[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98934.1
DDBJ      :             ABC transporter substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  234/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->322 2qh8A PDBj 6e-54 36.6 %
:RPS:PDB   34->300 3d8uB PDBj 4e-21 10.3 %
:RPS:SCOP  37->293 1bykA  c.93.1.1 * 1e-13 9.7 %
:HMM:SCOP  31->248 2livA_ c.93.1.1 * 5.7e-13 20.4 %
:RPS:PFM   49->322 PF04392 * ABC_sub_bind 1e-61 51.3 %
:HMM:PFM   34->323 PF04392 * ABC_sub_bind 2.8e-86 36.3 289/294  
:BLT:SWISS 35->305 Y367_RICPR 3e-14 25.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98934.1 GT:GENE ABD98934.1 GT:PRODUCT ABC transporter substrate-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 134991..135983 GB:FROM 134991 GB:TO 135983 GB:DIRECTION + GB:PRODUCT ABC transporter substrate-binding protein GB:NOTE COG2984 [R] ABC-type uncharacterized transport system, periplasmic component GB:PROTEIN_ID ABD98934.1 GB:DB_XREF GI:90820295 LENGTH 330 SQ:AASEQ MKRLIATIIALAVFLGVAFNVEKKQEESKNKMPTVAILQTLSHPALDQIHQGIVDGLKEEGFVNGKTMKIDYQNAQGDQSNLKTMSDRFVQEKASVLIGIATPAVQSLANENSKIPITMGAVSDPVGTGLVKTLEKPGGTVSGVMHKEPVAAQVKLIREFMPDLKNIGVIYTSSDDSSTAEYKEFKKLAEKAGITVKTYTITSTNDIDQVSATMASEVQAVYVPSDNTVASGFSTLVKNTNAKNIPIFPGVDSMIKGGGVATVSVSQYELGKLTGKMAAQELRGKNPATMPVETVKKGSTVINQKQADKLGLKVPASAIKQANEKGEIIK GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 35->305|Y367_RICPR|3e-14|25.1|251/303| TM:NTM 1 TM:REGION 4->22| BL:PDB:NREP 1 BL:PDB:REP 31->322|2qh8A|6e-54|36.6|290/294| RP:PDB:NREP 1 RP:PDB:REP 34->300|3d8uB|4e-21|10.3|252/266| RP:PFM:NREP 1 RP:PFM:REP 49->322|PF04392|1e-61|51.3|271/279|ABC_sub_bind| HM:PFM:NREP 1 HM:PFM:REP 34->323|PF04392|2.8e-86|36.3|289/294|ABC_sub_bind| RP:SCP:NREP 1 RP:SCP:REP 37->293|1bykA|1e-13|9.7|237/255|c.93.1.1| HM:SCP:REP 31->248|2livA_|5.7e-13|20.4|211/344|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 340 OP:NHOMOORG 234 OP:PATTERN -------------------------------------------------------------------- -----1-1111------------------------------1-------------11-----------------------------------------------------------------------------1---------------------------------------------------------1----------------1--------1221---------21--------------------112134-1111222233111111---22213332111111111112111111111111111332223333--3-22222222-21-211-------1-1-2--54-3-11-1------13-------111-1--3-1--------11111111111---C----211--111-11-2111111--------------------------1-1------------1111-11--111-----------11111-1111--1111111-1111111-42131--1111-1111--1----1-----1-----------1---2-111---3---12121232---------2-------------------------------1-----2----------------------------------------------------------------------------------------------------------------------------------2-------------1----------222--1111--------------------------11111111211----------------13-------------------------------------------11---1----1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 308 STR:RPRED 93.3 SQ:SECSTR ##############HTccccHHHHHHHTTcccccEEEEcccccHHHHHHHHHHHHHHHHHTcEEEEEEcEEEEEccccHHHHHHHHHHHHTTccccEEEEcccccHHHHHHHHHTTccEEEEcccccEEEEccccccccEEEcccHHHHHHHHHHHHHHTTccccEEEEEEcTTcHHHHHHHHHHHHHHHTTcccccEEEEcccccHHHHHHHHHHTccEEEEccHHHHHHHHHHHHHTccTTTTcEEEEccccHHHTccccEEEccHHHHHHHHHHHHHHHccccccccccEEEccGGGEEcHHHHHHTTccccHHHHHHc######## DISOP:02AL 1-2,21-34| PSIPRED cHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEcccHHHHHHHHccccccEEEEEcccHHHcEEccccccccccEEEEEccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHccccEEEccHHHHHcccEEEEEccHHHHHHHHHHHHHHHHccccHHHcccEEccccEEEEcHHHHHHHcccccHHHHHHHHHccEEcc //