[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98937.1
DDBJ      :             Hypothetical secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   92->208 1zatA PDBj 3e-04 25.7 %
:RPS:SCOP  86->208 1zatA1  b.160.1.1 * 1e-24 21.6 %
:HMM:SCOP  81->208 1zatA1 b.160.1.1 * 2.7e-30 29.8 %
:RPS:PFM   86->207 PF03734 * YkuD 6e-06 30.9 %
:HMM:PFM   86->208 PF03734 * YkuD 1e-27 32.4 108/116  
:HMM:PFM   3->65 PF07423 * DUF1510 1.8e-05 27.0 63/217  
:BLT:SWISS 87->208 Y493_MYCBO 2e-05 25.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98937.1 GT:GENE ABD98937.1 GT:PRODUCT Hypothetical secreted protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(137678..138307) GB:FROM 137678 GB:TO 138307 GB:DIRECTION - GB:PRODUCT Hypothetical secreted protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD98937.1 GB:DB_XREF GI:90820298 LENGTH 209 SQ:AASEQ MPSRSEKFSKRKHQQNFFKFLLILVVIAVGGYKLLFNYAKNTASQNINSSSSSVETVVTHQASKVDWQSPSEKKPYPDVNAYPNMWVKVSTSKHRVYLMNGNKVLYTMLCSTGSKGQETPKGTFEIQAERGDHFYNAQSGEGANYWVSFKDHGIYLFHTVPVDANGNYVVSEAEQLGKSSNSHGCVRLSVADAKWFYENIKTGTKVVVE GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 87->208|Y493_MYCBO|2e-05|25.4|114/451| TM:NTM 1 TM:REGION 14->36| SEG 41->59|ntasqninsssssvetvvt| BL:PDB:NREP 1 BL:PDB:REP 92->208|1zatA|3e-04|25.7|109/248| RP:PFM:NREP 1 RP:PFM:REP 86->207|PF03734|6e-06|30.9|110/136|YkuD| HM:PFM:NREP 2 HM:PFM:REP 86->208|PF03734|1e-27|32.4|108/116|YkuD| HM:PFM:REP 3->65|PF07423|1.8e-05|27.0|63/217|DUF1510| RP:SCP:NREP 1 RP:SCP:REP 86->208|1zatA1|1e-24|21.6|116/126|b.160.1.1| HM:SCP:REP 81->208|1zatA1|2.7e-30|29.8|121/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 67 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- --------------------------------------22------------------------------------111----------------------------------------------------------------------1--------------1----1--------------------------------------------1---------------------------------------211112121-331111121--1---111-1-1-------------------------------------1--221111111212----2111-1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 52.2 SQ:SECSTR ###########################################################################################TTEEEEEETTEEEEEEEccc#ccTTcccccEEEEccccEEEEEcccccccEEEEEEEccccccEEE#######EcTTcccccTTHHHHHcccccEEEcHHHHHHHHHHccTTcEEEE# DISOP:02AL 1-12,44-52,64-75| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccccccccccccHHHHHHHHHccccHHcccccccccccccccccEEEEEEccccEEEEEEccEEEEEEEEEEccccccccccEEEEEEEEcccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEc //