[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98947.1
DDBJ      :             ABC transporter substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  541/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:280 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->271 1p99A PDBj 7e-47 42.3 %
:RPS:PDB   49->261 1dtzA PDBj 3e-16 9.0 %
:RPS:SCOP  46->274 1p99A  c.94.1.1 * 3e-71 43.4 %
:HMM:SCOP  34->275 1p99A_ c.94.1.1 * 3.9e-78 47.9 %
:RPS:PFM   52->274 PF03180 * Lipoprotein_9 7e-50 51.6 %
:HMM:PFM   36->275 PF03180 * Lipoprotein_9 6.6e-94 49.6 236/237  
:BLT:SWISS 46->275 METQ_YERPE 2e-44 41.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98947.1 GT:GENE ABD98947.1 GT:PRODUCT ABC transporter substrate-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 147764..148606 GB:FROM 147764 GB:TO 148606 GB:DIRECTION + GB:PRODUCT ABC transporter substrate-binding protein GB:NOTE COG1464 [P] ABC-type metal ion transport system, periplasmic component/surface antigen GB:PROTEIN_ID ABD98947.1 GB:DB_XREF GI:90820308 LENGTH 280 SQ:AASEQ MRRKGLLGFIAVIIVIAVAAFFTFGHKKTEAKKTVTVGVVGQTNQDEKIWNQVKKTAKEKYGVTVKVKSFTDYNQPNKALQEGEIDLNSFQHKAFLNAWNKANKGTLVPIGNTVIAPIRLYSYKYKNINELPKNATIAVPNDASNESRALYVLKNAGLISFKKGTGKLATIADIEKNPKNLTIKELGAEQTARSLNDVDAAVVNNTYAIPAKLGDKQTIYTEPLNKDSEQWINVIVANKKDKDNEAYKAVVKSYQTDAVKKLIHKTYGNSEVTAWNLKLK GT:EXON 1|1-280:0| BL:SWS:NREP 1 BL:SWS:REP 46->275|METQ_YERPE|2e-44|41.4|227/271| TM:NTM 1 TM:REGION 5->25| SEG 9->22|fiaviiviavaaff| SEG 27->43|kkteakktvtvgvvgqt| BL:PDB:NREP 1 BL:PDB:REP 44->271|1p99A|7e-47|42.3|227/255| RP:PDB:NREP 1 RP:PDB:REP 49->261|1dtzA|3e-16|9.0|212/689| RP:PFM:NREP 1 RP:PFM:REP 52->274|PF03180|7e-50|51.6|221/236|Lipoprotein_9| HM:PFM:NREP 1 HM:PFM:REP 36->275|PF03180|6.6e-94|49.6|236/237|Lipoprotein_9| RP:SCP:NREP 1 RP:SCP:REP 46->274|1p99A|3e-71|43.4|228/257|c.94.1.1| HM:SCP:REP 34->275|1p99A_|3.9e-78|47.9|238/255|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1066 OP:NHOMOORG 544 OP:PATTERN -------------------------------------------------------------------- -----2211111111----------2------1121112-----121211111-1111-----111121111222111-122-------------------1---------------11111111----------------------------------------------------------1-2------12444444442444444313312344112244322222223322222222222222422223212232311132334412123244433341111111111111111111111111111111112221111-2112333333313--2221---111211----11-1-11-1-11-1-11---111-111-11-125---322-222222222213---2--2-2-1--21121111111132-----11411---11111111-11---13-----------------------------------343435455552444255434444235485244--222--2228-113--------111111111--------------1-------------------1----2211444441121111111-1-----221-1-----1--------------------------------43431422222222222-2222222222222222221676441142222222222222222422211121-322222222222--1-111111111---1-22211111111211144444321111-33333543234341333111111111-1111111111211111111111111111---4---------------11---------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------4-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 84.6 SQ:SECSTR ###########################################HHHHHHHHHHHHHHHTTTcccEEEEEcccHHHHHHHHHTTccccEEEcHHHHHHHHcTTTcEEEEccccEEEEEEEEEccccccGGGcGTTcEEEEccTTcTTTTHHHHTGGGTccccTTccHHHHHHHHccEEEcTTccTTTcHHHHTTccccGGGTTcccTTcTcHHHHHHHHHHcccccEEEEETTHHHHHcccHHHHTTEEEEETTTEEEcGGGTTTcccEEEEccEEGcccE DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHcccccEEEEccHHHHHHHHHHccccEEEEEEEEEEEEEEEccccccHHHcccccEEEEccccccHHHHHHHHHHcccEEEcccccccccHHHHHHcccccEEEEEcHHHHHHHcccccEEEEcccHHHHcccccHHHEEEcccccccccEEEEEEEcHHHcccHHHHHHHHHHccHHHHHHHHHHcccccccccccccc //