[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98953.1
DDBJ      :             3-hydroxybutyryl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  546/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->282 3hadA PDBj 2e-32 30.7 %
:RPS:PDB   5->280 2dpoA PDBj 9e-28 21.0 %
:RPS:SCOP  5->171 1dliA2  c.2.1.6 * 3e-14 13.0 %
:RPS:SCOP  186->280 1f0yA1  a.100.1.3 * 1e-18 38.9 %
:HMM:SCOP  1->184 1f0yA2 c.2.1.6 * 1.1e-40 32.6 %
:HMM:SCOP  186->281 3hdhA1 a.100.1.3 * 5.8e-20 36.5 %
:RPS:PFM   5->181 PF02737 * 3HCDH_N 8e-25 34.3 %
:RPS:PFM   186->279 PF00725 * 3HCDH 4e-12 39.4 %
:HMM:PFM   5->181 PF02737 * 3HCDH_N 1e-42 32.0 175/180  
:HMM:PFM   186->280 PF00725 * 3HCDH 6.5e-21 37.9 95/97  
:BLT:SWISS 4->280 HCDH_HUMAN 2e-31 30.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98953.1 GT:GENE ABD98953.1 GT:PRODUCT 3-hydroxybutyryl-CoA dehydrogenase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 153287..154168 GB:FROM 153287 GB:TO 154168 GB:DIRECTION + GB:PRODUCT 3-hydroxybutyryl-CoA dehydrogenase GB:NOTE COG1250 [I] 3-hydroxyacyl-CoA dehydrogenase GB:PROTEIN_ID ABD98953.1 GB:DB_XREF GI:90820314 LENGTH 293 SQ:AASEQ MSFKKITIAGAGTLGSQIAFQAAFYGFTVSIWNPHPDRAIRRLNKVQKMYKQEMGITDSDVKRAMKNIVEITNDMEIATKNTEYVIESVPENLEIKGIFYQKMCQVLPKDVILASNSSTLVPSQLVKFVDRPEKFLHMHFANHIWKFNTSEIVGNEKTDKEVIDKVVEFAKEINMLPIVLKKEQSGYIMNSLSVPYLNAALGLWAKGVADPMTIDKDWMKATGSPMGPFMSLDAIGLRTTYAIFNAHAEDAAAKAIADKLKQMIDEGHYGIEAGEGFYKYPHPAYESADFLKV GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 4->280|HCDH_HUMAN|2e-31|30.5|275/314| SEG 246->257|ahaedaaakaia| BL:PDB:NREP 1 BL:PDB:REP 4->282|3hadA|2e-32|30.7|277/293| RP:PDB:NREP 1 RP:PDB:REP 5->280|2dpoA|9e-28|21.0|267/310| RP:PFM:NREP 2 RP:PFM:REP 5->181|PF02737|8e-25|34.3|175/180|3HCDH_N| RP:PFM:REP 186->279|PF00725|4e-12|39.4|94/97|3HCDH| HM:PFM:NREP 2 HM:PFM:REP 5->181|PF02737|1e-42|32.0|175/180|3HCDH_N| HM:PFM:REP 186->280|PF00725|6.5e-21|37.9|95/97|3HCDH| GO:PFM:NREP 4 GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF02737|IPR006176| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02737|IPR006176| GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF00725|IPR006108| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00725|IPR006108| RP:SCP:NREP 2 RP:SCP:REP 5->171|1dliA2|3e-14|13.0|162/196|c.2.1.6| RP:SCP:REP 186->280|1f0yA1|1e-18|38.9|95/99|a.100.1.3| HM:SCP:REP 1->184|1f0yA2|1.1e-40|32.6|184/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 186->281|3hdhA1|5.8e-20|36.5|96/99|a.100.1.3|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 2027 OP:NHOMOORG 739 OP:PATTERN 11-1--4655555544-111121942221-2411---------------------------2331-11 13238--3--123263323-322237333333332356991153-1221311323423--446-4548882-----1111-13-----------11---3-221132331------------------------1---------2-1--1-------------------1-------------23322---3222222221332132211322312223342321------32111111111111111211-2--1----1-----11---1-------111----------------------------------------2-1112111111111211222111-1-314112-551317-24---1--1-3-15332-----236552222332334443343445-22722825763-422223433244332222464343437--------3---1331------------------1--1--1----11261-2542677666744555666455554596D58652355335554644576--2----12-------11-7432734-----------34314-11-12115412---------------------------22-321224322222222222223222223---21--------3222-223223333243-233322242322222322333322322222222222222222251222222--222222222222---2111113333-2422111--------1---55535333325-66554553454573112111111111-222222222222221111111111------11--1111--------1---------------------------------------- ----113-421-222133233333534111111111122222211111243445112214341--------------------------1-131113222222222-5649734323-211331321437N3-434112-32232-321-22131432548926533535-5B7221-1H1112244642322143323 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 100.0 SQ:SECSTR GGGcEEEEEcccHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHHHHHHHHHTTcccccccHHHHHHTEEEEccHHHHTTTEEEEEEcccccHHHHHHHHHHHHTTcccccEEEEccccccHHHHHTTcTTGGGEEEEEEcccTTTccEEEEEEcTTccHHHHHHHHHHHHHTTcEEEEcccccTTTTHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHTTHHHHccHHHHHHHTTTcHHHHHTccccEEccHHHHHHHHHHHHTccccccccHHHHHHHccccccccHHHHH DISOP:02AL 1-1,53-64,288-288| PSIPRED cccEEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHcccHHHEEEccccccHHcccEEEEEccccccHHHHHHHHHHHHHHccEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccEEccccccc //