[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98954.1
DDBJ      :             NADH peroxidase
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  564/915 : Eukaryota  95/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.87.1
:451 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->448 1nhrA PDBj e-156 59.6 %
:RPS:PDB   1->445 2bc0A PDBj 1e-49 26.9 %
:RPS:SCOP  96->320 1gv4A1  c.3.1.5 * 9e-21 12.4 %
:RPS:SCOP  322->448 1f8wA3  d.87.1.1 * 2e-21 64.8 %
:HMM:SCOP  1->319 1f8rA1 c.3.1.2 * 2.1e-39 28.8 %
:HMM:SCOP  322->449 1nhpA3 d.87.1.1 * 2.8e-29 32.5 %
:RPS:PFM   64->281 PF07992 * Pyr_redox_2 4e-10 27.2 %
:HMM:PFM   2->283 PF07992 * Pyr_redox_2 1.7e-36 25.4 197/202  
:HMM:PFM   331->430 PF02852 * Pyr_redox_dim 4.4e-12 25.3 95/110  
:BLT:SWISS 1->448 NAPE_ENTFA e-156 59.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98954.1 GT:GENE ABD98954.1 GT:PRODUCT NADH peroxidase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(154226..155581) GB:FROM 154226 GB:TO 155581 GB:DIRECTION - GB:PRODUCT NADH peroxidase GB:NOTE COG0446 [R] Uncharacterized NAD(FAD)-dependent dehydrogenases GB:PROTEIN_ID ABD98954.1 GB:DB_XREF GI:90820315 LENGTH 451 SQ:AASEQ MKVIVVGSSHGGYEAVEGLLKDYPDAEIQWYEQGDFLSFLSCGMQMFLEGKVDSADKVRYMTPEAIRERGVSLFEQTQVFALHSADHEIEVKDLQTGEVRTENYDKLILSPGAVPMELDVPGKNLENVYYMRGHDWAVKLKEKVLDNNVKNVVVIGSGYIGIEAAEVFAKAGKSVEVLDMLPRPLATYLDKELTDVIEPELTQNNVHVHGDQLVQEYLGENAVTGVKTDKGEYSADLVVVAAGVKPNTAWLKDELAMYPNGMVKTDNFMRSSADDVFVVGDATLLKYNPGNTLLNVALATNARKQGRFAVKNLEAPLHPFPGVQGTSALSVFDYKFASSGLNATNAQKLGKQVRSVVVEDDFRMDFVPKEENAYVWFKLTYDPDTKAILGGQILSKHDLTAYINVISLAIKTKQTIYDLAYEDFFFQPGFDKPWNILNLAGLAAEKQEDED GT:EXON 1|1-451:0| BL:SWS:NREP 1 BL:SWS:REP 1->448|NAPE_ENTFA|e-156|59.6|446/447| SEG 138->154|vklkekvldnnvknvvv| BL:PDB:NREP 1 BL:PDB:REP 1->448|1nhrA|e-156|59.6|446/447| RP:PDB:NREP 1 RP:PDB:REP 1->445|2bc0A|1e-49|26.9|442/472| RP:PFM:NREP 1 RP:PFM:REP 64->281|PF07992|4e-10|27.2|206/275|Pyr_redox_2| HM:PFM:NREP 2 HM:PFM:REP 2->283|PF07992|1.7e-36|25.4|197/202|Pyr_redox_2| HM:PFM:REP 331->430|PF02852|4.4e-12|25.3|95/110|Pyr_redox_dim| RP:SCP:NREP 2 RP:SCP:REP 96->320|1gv4A1|9e-21|12.4|210/224|c.3.1.5| RP:SCP:REP 322->448|1f8wA3|2e-21|64.8|125/126|d.87.1.1| HM:SCP:REP 1->319|1f8rA1|2.1e-39|28.8|292/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| HM:SCP:REP 322->449|1nhpA3|2.8e-29|32.5|126/126|d.87.1.1|1/1|FAD/NAD-linked reductases, dimerisation (C-terminal) domain| OP:NHOMO 1241 OP:NHOMOORG 711 OP:PATTERN --11-12333344432121122253112223212111111111----------122324421111--- --121112222---22222-25--2222222123331348-1------2---1-2-----115--14222--1111111--1111---1111-111-------1-1-------------------11-11-11212211--11122-----------------------1-------------1111131-23-44444424244543443111-444-2-234321111112333222222233322464334231331221188324433423-434422311121111112111111222222222222213311133343-1-5333333333224111111521111-11154122323114444223--21--1-----4221122--121111111122111---112111-31-211-235224---3311111-1--121---------11--1-1---------1--------------------1131-211---11-2--111111-31111-12-4122-1----11----22221--31-11---------22-32--55332121251111111-221411111--13----------------------1-211212341--1-1--11-12-----1----11---11--------1-1-1--1111111111-111111-1-1111111111111------111111111111111-1111111---11111111111---1---------231-----------------1111112---1-21111-21-111---1-11---1--121-211111121122----1----------113------1111111121311112-2-21111111132111---111122-232--- 1-------1--111111---1-1---1111111111-11111111111---2171111----------------------------11--2-1111-1----1------1232332-11---1133-2------1------1111-1--------111213--21116--2111-111-----123222-3311----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 450 STR:RPRED 99.8 SQ:SECSTR cEEEEEcccHHHHHHHHHHHHHHGGGcEEEEEcccccccccGGHHHHHTTcccccGGGccccHHHHHHTTcEEETTccEEEEETTTTEEEEEETTEEcEEEEEccEEEEcccEEEccccccTccccTTcTcccHHHHHHHHHHTTcTTccEEEEEcccHHHHHHHHHHHHTTcEEEEEEccccTTTTTccHHHHHHHHHHHHTTTcEEEETccEEEEEccccccEEEEcccEEEccEEEEcccEEEccGGGTTcccccTTccccccTTcccccTTEEEcGGGccEEETTTTEEEccccHHHHHHHHHHHHHHHTTcccccccccccEEEEETTEEEEEEEccHHHHHHTTccEEEEEEEEEcccTTcccccEcEEEEEEEEETTTccEEEEEEEEccccTTHHHHHHHHHHHTccHHHHHHccccccTTTccTTcHHHHHHHTccHHcHc# DISOP:02AL 448-452| PSIPRED cEEEEEcccHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHccccccHHHHHcccHHHHHHcccEEEEccEEEEEEccccEEEEEEcccccEEEEEccEEEEccccEEccccccccccccEEEEccHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEcccEEEEcEEEEEcccEEccHHHccccEEEccccEEEccEEEcccccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHccccccccccccEEEEEEEcccEEEEEccHHHHHHccccEEEEEEEcccccEEEEcccccEEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHccccHHHHHcccEEcccccccHHHHHHHHHHHHHHHHccc //