[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98959.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:184 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98959.1 GT:GENE ABD98959.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(161821..162375) GB:FROM 161821 GB:TO 162375 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABD98959.1 GB:DB_XREF GI:90820320 LENGTH 184 SQ:AASEQ MTKNELILPSKDELLETLEKRFKKFPQRHQNLQWEEILLLIEDKPESINSLAYLEASGGEPDVTEINKQIVFIDFSKESPKGRRSLCYDKNARINRKKFPPTSSVCEVCEQWQIELLTEDDYHSLQEIQPVDLKTSSWLFTPDNIRQLGGAIFGDRRYDTTFIYHNGADSYYASRGFRAKLILK GT:EXON 1|1-184:0| OP:NHOMO 56 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------1-1---111-1---------------------------11--1111-------------------------------------------------11111111-111111------111---1111----------------------------------------------1-------------------------------------------------------------------------------1----11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-----1-----------------------------------------------------------111111----------1------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,94-104| PSIPRED ccHHHccHHHHHHHHHHHHHHHHHcHHHcccccHHHHHHHHHccHHHHHHHHHHHHccccccEEcccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHcHHHHcHHHHHHHHHHccccccccHHccccHHHHHccccEEEEccccEEEEEEcccHHHHHHccccEEEEEc //