[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98973.1
DDBJ      :             Integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  102/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->235 PF06161 * DUF975 2e-29 43.7 %
:HMM:PFM   1->150 PF06161 * DUF975 1.7e-18 27.3 121/243  
:HMM:PFM   143->236 PF06161 * DUF975 3.5e-33 51.1 88/243  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98973.1 GT:GENE ABD98973.1 GT:PRODUCT Integral membrane protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 183230..183994 GB:FROM 183230 GB:TO 183994 GB:DIRECTION + GB:PRODUCT Integral membrane protein GB:NOTE COG0392 [S] Predicted integral membrane protein GB:PROTEIN_ID ABD98973.1 GB:DB_XREF GI:90820334 LENGTH 254 SQ:AASEQ MATRAELKNEVKDAFRGNWKKAIGLSIIPIVFTVITVFTVSIFLQVLLLVIRNNPATFSDVPNDVAANSTGNGGTYSTNIVSSIIGIMIYLGIQYTFLDWLRGKSVESINNFRSMFQVFSKRYFIPVLVMYIIQWVLQFLWSLLFIIPGIIKGYSYSQTYFIYKDIEASGAKANYKYPDYVTLSRELMNGHKWELFLLDLSFIGWHIVSILTFGLGYIWLIPYMSATKAAFYRNLAGDKFLKQDRVYDAEFKEM GT:EXON 1|1-254:0| TM:NTM 4 TM:REGION 27->49| TM:REGION 76->98| TM:REGION 128->150| TM:REGION 197->219| SEG 26->43|siipivftvitvftvsif| RP:PFM:NREP 1 RP:PFM:REP 6->235|PF06161|2e-29|43.7|199/214|DUF975| HM:PFM:NREP 2 HM:PFM:REP 1->150|PF06161|1.7e-18|27.3|121/243|DUF975| HM:PFM:REP 143->236|PF06161|3.5e-33|51.1|88/243|DUF975| OP:NHOMO 143 OP:NHOMOORG 102 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1--------11----------------------------------------------------------------------------------------------------1-333331232213242------324-----22111111-2---------------------11-22--21111--2221121----111-11111111111-111111111111111111111---1111--1-21111111-1--1---112--2---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,248-248,254-255| PSIPRED cccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccHHccc //