[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98977.1
DDBJ      :             Converved hypothetical protein
Swiss-Prot:Y162_LACS1   RecName: Full=UPF0210 protein LSL_0162;

Homologs  Archaea  27/68 : Bacteria  133/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.7.1
:447 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->442 2ha9A PDBj e-110 62.1 %
:RPS:SCOP  2->442 2ha9A1  c.7.1.5 * e-156 65.8 %
:RPS:PFM   5->411 PF05167 * DUF711 e-152 73.6 %
:HMM:PFM   11->432 PF05167 * DUF711 7.6e-183 66.9 396/399  
:BLT:SWISS 1->447 Y162_LACS1 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98977.1 GT:GENE ABD98977.1 GT:PRODUCT Converved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 186021..187364 GB:FROM 186021 GB:TO 187364 GB:DIRECTION + GB:PRODUCT Converved hypothetical protein GB:NOTE COG0011 [S] Uncharacterized conserved protein GB:PROTEIN_ID ABD98977.1 GB:DB_XREF GI:90820338 LENGTH 447 SQ:AASEQ MDTAQILETIKMISEENLDIRTITMGISLLDCIDSDSDKACQKIYDKITTKAKDLVKVGNQIATEYGIPVINKRVSVTPISLIAAASKDKDYVKYAKALDKAAQTLGIDFIGGYSALVQKGYQNGDRTLIKSLPQALAETNLVCASVNVGSTRSGINMDAVKEMGQVVKSASELDFMTNAKMVIFCNAVEDNPFMAGGFHGVGEPDAVINVGVSGPGVVKSALEKVKGASMDVVAETIKQTAFKVTRMGQLVGSIAAEKLNVPFGIVDLSLAPTPAVGDSVAQILEEIGLEQVGTHGTTAALAMLNDAVKKGGIMACSHVGGLSGAFIPVSEDAGMIDAVNAGSLNIEKLEAMTVVCSVGLDMIAIPGDTPAETISAMIADEAAIGMINNKTTAVRVVPVPGKDVGETVEFGGLLGHAPIMAVNKVSSADMINRGGLIPAPVHSFKN GT:EXON 1|1-447:0| SW:ID Y162_LACS1 SW:DE RecName: Full=UPF0210 protein LSL_0162; SW:GN OrderedLocusNames=LSL_0162; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->447|Y162_LACS1|0.0|100.0|447/447| SEG 27->38|islldcidsdsd| BL:PDB:NREP 1 BL:PDB:REP 2->442|2ha9A|e-110|62.1|396/397| RP:PFM:NREP 1 RP:PFM:REP 5->411|PF05167|e-152|73.6|406/418|DUF711| HM:PFM:NREP 1 HM:PFM:REP 11->432|PF05167|7.6e-183|66.9|396/399|DUF711| RP:SCP:NREP 1 RP:SCP:REP 2->442|2ha9A1|e-156|65.8|412/413|c.7.1.5| OP:NHOMO 168 OP:NHOMOORG 165 OP:PATTERN ---1-11--------1-122111------------11111111--111-11111----------1--- --1--111111111----------------------------------------------------1----11111111111---------------------------------------------------------11----1-----------------------1-------------------------------------------------------111111-------------------------11111-1-111111-1-111111----11111111-11111111-------------111111111111-11-------1-11111111-1111--111111111-1-111--1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-------11-11111-----1-------11-------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1--------------------------------------------------------------------------------------------------------------------------------------- ------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 398 STR:RPRED 89.0 SQ:SECSTR #cHHHHHHHHH#HHHccccEEEEE#EEccGGGccccHHHHHHHHHHHHHHHTTTHHHHHHHHHHHHTccEEEEEEEEccHHHHHHTccccccHHHHHHHHHHHHHHTccEEEEEEEEcTTcccTTHHHHHHHHHHHHHccccEEEEEEcEETTTEEE#HHHHH#HHHHHHHHTTccGG#GGEEEEEcccTTcccccTccccTTcccEEEEEEEccHHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHHHHHHHH#HHHHHTcEEEEEccccccc##ccccHHHHHHH#HcccTTcTTHHHHHHHHHHHHHHHHH#TcccHH#########cccHH#HHHHHTTcccHHHHHH#TTccc####cEEEc#TTccHHHHHHHHHHHHHHHH#HccEEEEEEE#cccT#######Tcccccccc#cccccccHHHHHTc############ DISOP:02AL 1-2,444-444,446-448| PSIPRED ccHHHHHHHHHHHHHccccEEEEEHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccccccccEEEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccEEEEHHHccEEEEEEcccccHHHHHHcccccccccccccc //