[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98983.1
DDBJ      :             Amino acid permease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  98/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:479 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   195->394 PF00324 * AA_permease 4e-04 22.2 %
:HMM:PFM   27->461 PF00324 * AA_permease 1.2e-22 16.5 418/479  
:BLT:SWISS 9->451 YCAM_ECOLI 8e-81 36.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98983.1 GT:GENE ABD98983.1 GT:PRODUCT Amino acid permease GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(193380..194819) GB:FROM 193380 GB:TO 194819 GB:DIRECTION - GB:PRODUCT Amino acid permease GB:NOTE COG0531 [E] Amino acid transporters GB:PROTEIN_ID ABD98983.1 GB:DB_XREF GI:90820344 LENGTH 479 SQ:AASEQ MLDQKKHYMSWPVIALLDFVTIISFENIFYPFQNQGLSVVISWIFLLFTYVIPYALIATQLGLTFDNQDGGLASWIRRGTHSDLFGYITSWMYWTQTIPYLVDVSNSVIVSISWIILGNNTLGHHMSTFTFGMLTFVIILLFIIFENVFRDSLEVLSIIGGGAMFLISMLFVFMTVWALTHGAHIATQPFNLHAFKPNFSLHYFSTTGLLIFAMSGAELAAPYINKMRNPKRDFPKAMWMLALMTAFLTIFGTLSLAVFFNANHIPNDFKMNGPYYAFKLLGEQVGMGKSLMYVFAVVQLMFMLAQLAILIDAASRVFASDTAAKYMPSWLIKKNKAGRPVHSYTLTAGISLLLLLLSGTLPNINSIYNWLLNLNGIVSPYKTALVFVAFLAIRWQEEQFKSDYVYIKNRTGALIVGFWCFIFTFVCATMGFIPQDAAPGTKAFDHQLFMNFVTVGFLVVLGFLLPWLRKLELKRAAKK GT:EXON 1|1-479:0| BL:SWS:NREP 1 BL:SWS:REP 9->451|YCAM_ECOLI|8e-81|36.6|440/476| TM:NTM 11 TM:REGION 8->30| TM:REGION 38->60| TM:REGION 98->120| TM:REGION 126->148| TM:REGION 155->177| TM:REGION 239->261| TM:REGION 289->311| TM:REGION 341->363| TM:REGION 373->395| TM:REGION 413->435| TM:REGION 447->468| SEG 102->116|vdvsnsvivsiswii| SEG 138->145|iillfiif| SEG 345->361|tltagisllllllsgtl| SEG 452->465|fvtvgflvvlgfll| SEG 468->478|lrklelkraak| RP:PFM:NREP 1 RP:PFM:REP 195->394|PF00324|4e-04|22.2|194/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 27->461|PF00324|1.2e-22|16.5|418/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 163 OP:NHOMOORG 98 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------24114331415111143233---212-------2--------------------------1-------------13333333233-1--1445----1----------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1---11-11111--1111-1111111--------1111111111111111------1------------------------1111-------------------------------------------------122212112----1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,475-480| PSIPRED cccccccccHHHHHHHHHHHHHHccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHEEcccEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccccHHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHEEcccccEEEEHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //