[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98991.1
DDBJ      :             Hypothetical protein, ErfK family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:246 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  91->230 1zatA1  b.160.1.1 * 1e-10 18.6 %
:HMM:SCOP  88->230 1zatA1 b.160.1.1 * 1.6e-10 22.1 %
:HMM:PFM   93->229 PF03734 * YkuD 3.1e-09 27.0 100/116  
:HMM:PFM   2->27 PF09976 * DUF2133 2.1e-05 26.9 26/43  
:HMM:PFM   15->111 PF00064 * Neur 0.00011 22.8 92/468  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98991.1 GT:GENE ABD98991.1 GT:PRODUCT Hypothetical protein, ErfK family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 202545..203285 GB:FROM 202545 GB:TO 203285 GB:DIRECTION + GB:PRODUCT Hypothetical protein, ErfK family GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD98991.1 GB:DB_XREF GI:90820352 LENGTH 246 SQ:AASEQ MKKNNLIYWIVAIILVGIAGWSAVHMHHLESKNAVKVSREMKISSSISRHIKKITKEQKKAMRKKVDWNKPSMTKAYPDVSKYKNVKKSNRIRLVVSSAKQRVYVMSGPYVLYTMYASLGKNYNSKTPNYQVTPVGKFKLEETRGDKFYDATRQLGGLHWTSFKGKGMYHFQSVPVDENGKVIEKDAKHLGSTKITKKNNIKAYGSIWLTVPDAEWIQKNLPVGTKVLIYGEDASSDNFIADNAKH GT:EXON 1|1-246:0| TM:NTM 2 TM:REGION 5->26| TM:REGION 102->121| SEG 42->56|kisssisrhikkitk| HM:PFM:NREP 3 HM:PFM:REP 93->229|PF03734|3.1e-09|27.0|100/116|YkuD| HM:PFM:REP 2->27|PF09976|2.1e-05|26.9|26/43|DUF2133| HM:PFM:REP 15->111|PF00064|0.00011|22.8|92/468|Neur| RP:SCP:NREP 1 RP:SCP:REP 91->230|1zatA1|1e-10|18.6|118/126|b.160.1.1| HM:SCP:REP 88->230|1zatA1|1.6e-10|22.1|122/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 37 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------211112121-331111121--1---111-1-1----------------------------------------1---------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,52-79,243-247| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcHHHHHHHHHHHHHcHHHHcccccccccccccccccHHccccccccccEEEEEEccccEEEEEEccEEEEEEEEEEccccccccccccccccEEEEEccccccccccccccccccEEEEEcccccEEEEEEEEcccccEEccHHHHcccccccccccccccEEEEccHHHHHHHHHHcccccEEEEEcccccccccccccccc //