[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD98996.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   16->113 PF07843 * DUF1634 2e-17 53.6 %
:HMM:PFM   16->117 PF07843 * DUF1634 3.1e-35 46.1 102/105  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98996.1 GT:GENE ABD98996.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(207879..208244) GB:FROM 207879 GB:TO 208244 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0344 [S] Predicted membrane protein GB:PROTEIN_ID ABD98996.1 GB:DB_XREF GI:90820357 LENGTH 121 SQ:AASEQ MDKKTKNEMETVEILIGKIMRIGVLIAASVMVIGFIMLVCQQSSGYPGTTFPTTLSEILKGITTFKPYAYMMAGIFLLILTPVLRVLVSIYAFYKEKDVLYVWITTIVFIILMFGFILGHH GT:EXON 1|1-121:0| TM:NTM 3 TM:REGION 16->38| TM:REGION 71->93| TM:REGION 97->118| RP:PFM:NREP 1 RP:PFM:REP 16->113|PF07843|2e-17|53.6|97/102|DUF1634| HM:PFM:NREP 1 HM:PFM:REP 16->117|PF07843|3.1e-35|46.1|102/105|DUF1634| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- 1------------------------------------------------------------------------------------------------------------1---------------11--------------------------------------------------------------------------------------------------111111------------------------1-11-----11--111111-1111-----------------------------------------------------------1-----------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccc //