[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99019.1
DDBJ      :             Aminotransferase class I and II
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  594/915 : Eukaryota  137/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:394 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->378 3dzzB PDBj 8e-66 37.1 %
:RPS:PDB   16->377 1d2fB PDBj 1e-34 25.6 %
:RPS:SCOP  1->377 1c7nA  c.67.1.3 * 4e-34 28.5 %
:HMM:SCOP  1->377 1c7nA_ c.67.1.3 * 2.5e-70 27.6 %
:RPS:PFM   84->373 PF00155 * Aminotran_1_2 2e-25 32.5 %
:HMM:PFM   26->373 PF00155 * Aminotran_1_2 3.2e-36 24.3 334/363  
:BLT:SWISS 3->377 CBL_BACSU 4e-56 35.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99019.1 GT:GENE ABD99019.1 GT:PRODUCT Aminotransferase class I and II GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 247349..248533 GB:FROM 247349 GB:TO 248533 GB:DIRECTION + GB:PRODUCT Aminotransferase class I and II GB:NOTE COG1168 [E] Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities GB:PROTEIN_ID ABD99019.1 GB:DB_XREF GI:90820380 LENGTH 394 SQ:AASEQ MYNFDKVAKFQNSLKWHVNDNELPMTLGDMDFEVAPEIITELHKRIEGKNFGYEYIPYEYYASVAKWYKEMYNCTLDISWMSFSQGVVATLSAIITNLMSEDSVITVLTPGFDKFKKVGEGKQKVLVSELIYDKEKRDYDINWLDLEDKLKKTNLFVLCNPHSPVGKIWSQKDLEKILKLSLKYDFKIFSDEIHGEITFEKKYTPLFSLDEKLLKNTIIAVSPSKAFNIAGIQTATIITPNKELKEQVDNAIKSFHLNEANSLAVPATIAAYTEGRVWLEELKDYLRENRNFIERFLEHNVPDVKPSLNEASYFLWLDISSLNVDAQELTKFIRKKTGLILTAGDKFDGNGKQFLRMNIATSTDLIEDALRRLQRAVVLFKRKDDDLMSLILNK GT:EXON 1|1-394:0| BL:SWS:NREP 1 BL:SWS:REP 3->377|CBL_BACSU|4e-56|35.1|373/387| BL:PDB:NREP 1 BL:PDB:REP 2->378|3dzzB|8e-66|37.1|367/374| RP:PDB:NREP 1 RP:PDB:REP 16->377|1d2fB|1e-34|25.6|359/368| RP:PFM:NREP 1 RP:PFM:REP 84->373|PF00155|2e-25|32.5|277/341|Aminotran_1_2| HM:PFM:NREP 1 HM:PFM:REP 26->373|PF00155|3.2e-36|24.3|334/363|Aminotran_1_2| GO:PFM:NREP 3 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00155|IPR004839| GO:PFM GO:0016769|"GO:transferase activity, transferring nitrogenous groups"|PF00155|IPR004839| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00155|IPR004839| RP:SCP:NREP 1 RP:SCP:REP 1->377|1c7nA|4e-34|28.5|376/394|c.67.1.3| HM:SCP:REP 1->377|1c7nA_|2.5e-70|27.6|373/0|c.67.1.3|1/1|PLP-dependent transferases| OP:NHOMO 1579 OP:NHOMOORG 786 OP:PATTERN 11--21-11111111132--11-32221111221-11-111112111424244-3233334-113--- --1-122233413111122-2-11--21222-----1111---1-1-1-11-11-2-2--112-212-11122332222--4-23211444525--1-122422-221-2---------------1-2211--21112222---32-22-112--111-----212-1112---1----11--111221123144444443544344332444354443332413333333322222222122222211222153132434122442223-42-32222444211133333333333333111111111111132333333332425666666563632544444433312-322121-14113322252223-1--111-----2----11-111-1111-1111112------1--3------1-----1-----1-1321111131---------11---1------111------------------1-11-11--111-23231211111111321111111322322-2112--1211---1---1--1----------222113-341---3-12222-1111---11------2-4122-11111111111111133214112222211-1-----------------1--1----11-------22212222224254322-2232333232222222222222--111232323222333233242122222--211121122222---------222211-11-------1-11-11-323332212211-11--211-111---1-42232432212221-------11-----1------------311------------2----------1--------2-------4222212111234 ----111-----1111132222251611-1211422-2221221111122313113-111111221111111212-1-1113221211--111-1----1---1-1--112-22443-1---3-91-1-342-2231-1-2--71--21121-214212---123--4--23312----8331--3234333-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 391 STR:RPRED 99.2 SQ:SECSTR cccccccccccTcTTcccccccEEcccccccccccHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHHccccccGGGEEEEccHHHHHHHHHHHHccTTcEEEEEEcccTHHHHHHHHTTcEEEcEEEcEEETTEEEccHHHHHHHHTTEEEEEEEcccTTTcccccHHHHHHHHHHHHHTTcEEEEEcTTTTccccccccccGcGGGTccccEEEEEccHHHHTcGGGccEEEEEccHHHHHHHHHHHTTcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcTTTcccccccccEEEEEcGGGcccHHHHHHHHHHTTcEEcEEGGGGcGGGTTEEEEEccccHHHHHHHHHHHHHHHTcccccccHHHHHH### DISOP:02AL 388-388,393-395| PSIPRED cccHHHHHHHHHHHccccccccEEcccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHEEEEccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHccEEEEEEcccccccccccccccHHccccccccEEEEccccHHHHccHHHHEEEEEcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccEEEEEEEcccccccHHHHHHHHHHHccEEEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcc //