[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99020.1
DDBJ      :             Two-component response regulator
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  855/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->227 2oqrA PDBj 8e-34 35.0 %
:RPS:PDB   19->224 3c3wB PDBj 1e-27 25.8 %
:RPS:SCOP  19->118 1a0oA  c.23.1.1 * 7e-22 31.3 %
:RPS:SCOP  129->228 1gxpA  a.4.6.1 * 2e-25 31.6 %
:HMM:SCOP  1->140 1w25A2 c.23.1.1 * 4.2e-36 45.3 %
:HMM:SCOP  122->229 1ys7A1 a.4.6.1 * 1.8e-25 37.7 %
:RPS:PFM   20->113 PF00072 * Response_reg 4e-16 46.7 %
:RPS:PFM   150->226 PF00486 * Trans_reg_C 1e-15 45.5 %
:HMM:PFM   3->113 PF00072 * Response_reg 5.2e-29 41.8 110/112  
:HMM:PFM   150->226 PF00486 * Trans_reg_C 5.5e-28 48.1 77/77  
:BLT:SWISS 18->227 SRRA_STAAW 4e-43 41.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99020.1 GT:GENE ABD99020.1 GT:PRODUCT Two-component response regulator GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 248688..249377 GB:FROM 248688 GB:TO 249377 GB:DIRECTION + GB:PRODUCT Two-component response regulator GB:NOTE COG0745 [TK] Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain GB:PROTEIN_ID ABD99020.1 GB:DB_XREF GI:90820381 LENGTH 229 SQ:AASEQ MKILIVDDDKDIVELLSIYVENEGYEVEKAYNGKEALSKLNMNPDIALMILDVMMPQMDGMEVIREVRKESQIPVLILSAKTDDLDKIQGLVQGADDYVTKPFNPLEVMARVKSLLRRAEHNVKNNELDQIEIGPLIIKKDSHEVKTLEGKEIKLTALEFGILHLLASHPNRVFSADEIFERVWQQESVVSAKTVMVHVSHLRDKIEDATNGEQVIQTVWGVGYKIESH GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 18->227|SRRA_STAAW|4e-43|41.8|208/241| SEG 2->16|kilivdddkdivell| BL:PDB:NREP 1 BL:PDB:REP 20->227|2oqrA|8e-34|35.0|206/226| RP:PDB:NREP 1 RP:PDB:REP 19->224|3c3wB|1e-27|25.8|186/210| RP:PFM:NREP 2 RP:PFM:REP 20->113|PF00072|4e-16|46.7|92/111|Response_reg| RP:PFM:REP 150->226|PF00486|1e-15|45.5|77/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 3->113|PF00072|5.2e-29|41.8|110/112|Response_reg| HM:PFM:REP 150->226|PF00486|5.5e-28|48.1|77/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 19->118|1a0oA|7e-22|31.3|99/128|c.23.1.1| RP:SCP:REP 129->228|1gxpA|2e-25|31.6|98/103|a.4.6.1| HM:SCP:REP 1->140|1w25A2|4.2e-36|45.3|137/0|c.23.1.1|1/1|CheY-like| HM:SCP:REP 122->229|1ys7A1|1.8e-25|37.7|106/0|a.4.6.1|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 11712 OP:NHOMOORG 897 OP:PATTERN -----------------------------1-1---1--1111111-18-A422----1---------- 6NL7U466778555CBBAA-AG44CBAAAAA9HEFFAFEEBEEFBA688AA7BCF55811KIL7Q5GQPO8444455558JA715477KLaR-F22---77M4BBV9UAP--------------142343336284RPPPPKBFV6qWmiUTDJKEF876999MSJGot*N684565675545GE699341A7GXXYXYVWYIYVZZXUHKECBDXYf9ADW8FFA99A9Aid9AB9A99899AAA99899A6C675CC655466677CC755675686EFE97799AA888888988886666677778766A8767476788TKMiQQQVUUVSSMEeVV9EGBSLJ8BCFNA4gbSCA7566486A8228HBAHEEB66666FFNLMC8CFJDFHAA9AAAAA99D-GHIHHMIOCO91OHHLKIJQSMHGDL8C9DBEF9FFCCBBBBBBBBBAAB9ANJC2222222222333333333333323222237CE58AEDAFSUXUaRPIIIEPPVXKIKJCJZSTMRQY12KORaFKGFYKKOO9IPIBCABI71211111A85HPe9XPE84JB7SP77E1XSTONKRDGIEHEYW9BL9896888889434544444JNADL77MMAHKPQ7GGEMFLLIELJOLLKMLKKMPR--3797A------EFEFBFAEFFFEFFGEE-FGFEEEEEEGFEEEEEEEDHGHCE888EDEEEEEEDEEDEDEEGDCDDDEE81CDDDDDDDDDDD--2D3333356559Ib9R444333244443114EDBCE8BAACIIVTVVQaXcLUVYWKRQT3212132124GGHPHIIIIJJPOPOQIGKGHHHH7767--V3EE88993-1122123-2-------------------------4B445868675K3 ----22--------5--------------------------------------1---------------1------------------------1-222--1------2-------------------------------------------------1----2-1-------3-225-------3118--11-B---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 93.0 SQ:SECSTR ################HHHHHTcTTEEEEEccHHHHHHHHHHcccEEcTEEccEETTEEHHHHHHHHHHHTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHccGGGGccHHHHHHHHHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHTHHHHHHHHTccHHHHHHHHHHHHHHTTEcccccHHHHHHHHHTcEEccc DISOP:02AL 1-1,118-130| PSIPRED cEEEEEcccccHHHHHHHHHHHcccEEEEEccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHcccccccccccEEEEccEEEccccEEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEHHHHHHHHHHcccccccccEEEEEcccEEEEccc //