[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99023.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  295/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:389 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->286 1pw4A PDBj 4e-06 25.1 %
:RPS:SCOP  11->369 1pw4A  f.38.1.1 * 3e-17 16.5 %
:HMM:SCOP  1->385 1pw4A_ f.38.1.1 * 2.3e-79 28.2 %
:RPS:PFM   13->345 PF07690 * MFS_1 2e-17 22.6 %
:HMM:PFM   14->351 PF07690 * MFS_1 5.3e-57 24.5 335/353  
:BLT:SWISS 11->381 GUDP_ECOLI 1e-31 27.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99023.1 GT:GENE ABD99023.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 254666..255835 GB:FROM 254666 GB:TO 255835 GB:DIRECTION + GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0477 [GEPR] Permeases of the major facilitator superfamily GB:PROTEIN_ID ABD99023.1 GB:DB_XREF GI:90820384 LENGTH 389 SQ:AASEQ MKKSIKPIASLILLYIGYMLLFADRTVMNISMAYIGKEFQISPAALGATASAFFLGYTLMQIPGGIVTDILGSKKTVIISLILWSLLTAFTGLATSLMTLVVIRFLFGLAEGPYPSAALKQISEEYDKSDRSQATSVTISSNYAGAAIAPLIIVPIIASHGWRVSFYFLGILGLILVGLYYLIERPIKSKKETTTAKKINWREIDSRIWIFVIIGLVLNVITKGLETWMPIYFLQAQHINLKNLAWLVPLPVIAGGIAAFISGFVMVHIFRKRERWMIFISSLLTLIFMFGMYKSTTLVWIVIFEILVYFTKSLAFTGIFSFVAQILDEKTYGSSIGVVNFGGQLGGFIGPLLIGWLVQLSGSYSVAFVGLVVCALIAAITSTFVKNIK GT:EXON 1|1-389:0| BL:SWS:NREP 1 BL:SWS:REP 11->381|GUDP_ECOLI|1e-31|27.2|368/450| TM:NTM 10 TM:REGION 4->26| TM:REGION 39->61| TM:REGION 65->87| TM:REGION 90->112| TM:REGION 154->176| TM:REGION 203->225| TM:REGION 242->264| TM:REGION 275->297| TM:REGION 301->323| TM:REGION 356->378| SEG 144->158|agaaiapliivpiia| SEG 166->183|fyflgilglilvglyyli| BL:PDB:NREP 1 BL:PDB:REP 14->286|1pw4A|4e-06|25.1|271/434| RP:PFM:NREP 1 RP:PFM:REP 13->345|PF07690|2e-17|22.6|332/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 14->351|PF07690|5.3e-57|24.5|335/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 11->369|1pw4A|3e-17|16.5|358/434|f.38.1.1| HM:SCP:REP 1->385|1pw4A_|2.3e-79|28.2|383/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1070 OP:NHOMOORG 370 OP:PATTERN --------1111112--------1----1------1--------1-----111--11--1--11---- 228-1-----1------11-1---1511111--111-412-----2--------1--------1--7---------------2----------------------1-1-3---------------------------------------------------------------------------------2-21111112211211-2--66-2112--21---11111-2-111111111111111211111------1-----112--1-12----------------------------------------------------1------------11--------------31-11--1-2---------12--2-----4-722----5---1111111111----6--9-8----2-----------6-22---1-------21222222122-------------------------------------62-1----DGHDFC75443GGEC555527B894862--643-----2---3-21-----11--------------1-------1-------------------1-2-----------------------------41----11---------------------------------5362-414334444454-3435543535353444443BDC33-1-7163637666435334811-4443--122222222122---------------------1-----------55445-4---6-3332134826767-322111111111-----------------11111------------------------------------------------------------------ -------------------------1------------------------11-1--1--1-11----------------------------1--1-------------3--3122211------21------------1---1-------1--1-12-2211111---11211111122I211433476-53------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 69.7 SQ:SECSTR #############HHHHHHHHHHHHTcHHHHHHHTTcc#TTccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHTHHHHHHHHHTTcTTTHHHHHHHHHHHHHHHHTcHHHHHHHHHHHTcccTTcTHHHHHHHHHHHHHHHHHccccTTTcccc#cTHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTcHHHHHHHHHHHHHH####################################################################################################### DISOP:02AL 1-1,186-201| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcc //