[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99045.1
DDBJ      :             VEG protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  111/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->70 3fb9A PDBj 2e-06 42.6 %
:RPS:PFM   2->76 PF06257 * DUF1021 1e-15 46.7 %
:HMM:PFM   1->76 PF06257 * DUF1021 5.6e-33 48.7 76/76  
:BLT:SWISS 1->76 VEG_BACSU 2e-20 53.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99045.1 GT:GENE ABD99045.1 GT:PRODUCT VEG protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 284475..284708 GB:FROM 284475 GB:TO 284708 GB:DIRECTION + GB:PRODUCT VEG protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99045.1 GB:DB_XREF GI:90820406 LENGTH 77 SQ:AASEQ MPITITSIKAKLDGKIGEPLTITSRLGRKKSKTRHGVLRETFPSVFIIELNHDENAVERVSYSYTDILTKNIELNFG GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 1->76|VEG_BACSU|2e-20|53.9|76/100| BL:PDB:NREP 1 BL:PDB:REP 17->70|3fb9A|2e-06|42.6|54/89| RP:PFM:NREP 1 RP:PFM:REP 2->76|PF06257|1e-15|46.7|75/76|DUF1021| HM:PFM:NREP 1 HM:PFM:REP 1->76|PF06257|5.6e-33|48.7|76/76|DUF1021| OP:NHOMO 111 OP:NHOMOORG 111 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111-11111111111111111111111111-111111111111111------------------------------------------------11111111111-1-11111111--11-1-------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 70.1 SQ:SECSTR ################TcEEEEEEcccccccccEEEEEEEEcccEEEEEEcccTTccEEEEEEHHHHHTT####### DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEEEEEEEcccEEEEEEEcccccEEEEEEEEEEEEEEEEEEEEc //