[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99054.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   87->125 PF05135 * Phage_QLRG 5.1e-05 27.3 33/102  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99054.1 GT:GENE ABD99054.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(291941..292384) GB:FROM 291941 GB:TO 292384 GB:DIRECTION - GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99054.1 GB:DB_XREF GI:90820415 LENGTH 147 SQ:AASEQ MNDAEILKKILKKLSLKISKNESISLLYALYTTILLSKELFKFNVDIKNFLVPIFNKLQSQPEFSKQRKPLEFGDYVYRSRSLIIARFIRIIQKSEDKSIDILISAAQELVDSKYNNVSKKTPTTEKKKKSHKNSVDELLKIFGRYQ GT:EXON 1|1-147:0| SEG 6->27|ilkkilkklslkisknesisll| SEG 119->135|skktpttekkkkshkns| HM:PFM:NREP 1 HM:PFM:REP 87->125|PF05135|5.1e-05|27.3|33/102|Phage_QLRG| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,61-68,117-136| PSIPRED ccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccc //