[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99055.1
DDBJ      :             cII-like protein, phage associated
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  130/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->305 2ozeA PDBj 2e-07 31.0 %
:RPS:PDB   5->240 3ea0A PDBj 2e-14 16.8 %
:RPS:SCOP  5->297 1g3qA  c.37.1.10 * 6e-12 22.0 %
:HMM:SCOP  4->302 1fp6A_ c.37.1.10 * 8e-33 24.0 %
:RPS:PFM   138->227 PF01656 * CbiA 2e-08 35.4 %
:HMM:PFM   8->251 PF01656 * CbiA 3.5e-35 28.0 168/194  
:HMM:PFM   232->299 PF06648 * DUF1160 0.00083 17.2 64/122  
:BLT:SWISS 7->258 PARA_MYCGE 7e-14 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99055.1 GT:GENE ABD99055.1 GT:PRODUCT cII-like protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(292377..293300) GB:FROM 292377 GB:TO 293300 GB:DIRECTION - GB:PRODUCT cII-like protein, phage associated GB:NOTE COG0455 [D] ATPases involved in chromosome partitioning GB:PROTEIN_ID ABD99055.1 GB:DB_XREF GI:90820416 LENGTH 307 SQ:AASEQ MSDEGKVISFINMKGGVGKTTLTKEIGYHLATVKNLKVLLVDVDPQINLTQSVFRKFGFAPSESIAHSMEKSEETGSYRNIKVTKASIQNILNGNISNQNPTSDYTKAIVDIPNTNLSIIPDEFGLDFTNRNLNGGQLENGLYNFIYKNNLKNKFDYILIDCPPTYSSYTISALKPSDYYIIPVRPEAYSILGVNMLEEVIKQIKNENEVYFRDRSLRNLGIILSGVKENARKGIENLIEDIVSSSVLKDNNIEIFKNRFLYNPSLQSNMAYFITDGRAEKISKPNLNDLTNELLSRIKHMEGEKNE GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 7->258|PARA_MYCGE|7e-14|30.1|219/269| SEG 33->44|vknlkvllvdvd| BL:PDB:NREP 1 BL:PDB:REP 2->305|2ozeA|2e-07|31.0|245/284| RP:PDB:NREP 1 RP:PDB:REP 5->240|3ea0A|2e-14|16.8|190/237| RP:PFM:NREP 1 RP:PFM:REP 138->227|PF01656|2e-08|35.4|79/178|CbiA| HM:PFM:NREP 2 HM:PFM:REP 8->251|PF01656|3.5e-35|28.0|168/194|CbiA| HM:PFM:REP 232->299|PF06648|0.00083|17.2|64/122|DUF1160| RP:SCP:NREP 1 RP:SCP:REP 5->297|1g3qA|6e-12|22.0|227/237|c.37.1.10| HM:SCP:REP 4->302|1fp6A_|8e-33|24.0|246/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 146 OP:NHOMOORG 135 OP:PATTERN ---------------------------------1--1---------------------1-11------ -----------1------------------------------------------------------------------11-1-------1-1--111---1-11-----1--------------11111111-11------------11-111-----------1--111---------------1--11--11121221111111111--11--112--1-1----------2-------------------11--21---11--1111-1-11-------------------------------------------------11---------1---1---1--111---11------11-1--11-1----1-2-----111------------------------------1------------------------1-------------------------------------------------1-11----------------------------------------------------1------------------------1--1-1---------------------------1-1--------------------------------1---1--------------------------------1----------------------------------------1-------1----------------------------------11111------------------------------------------------------------------------1------------------------1111231111-1--------------11------1------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 99.3 SQ:SECSTR TccccEEEEEEEccTTccHHHHHHHHHHHHTTcTTccEEEEEccTTTccGccEGGTccccccccHHHHHHTGGGccHHHHHHcEEEETGGHHHHGGGccETTTccccEEEEEEccTEEEEccTccEEEEcccHHHHHHccHHHHHHHHHHHHHHccEEEEEEEccccTTHHHHGGGccEEEEEEcccHHHHHHHHHHHHHHHTcHHHccHHHTccccccEEEEEEcTTccTTccHHHHHHHHEEEEEEHHHGGGcccccccccHHHHHGGGGTccHHcTTcHHHHHHHHHHHHHHHHHHcccccc## DISOP:02AL 1-3,267-271,302-308| PSIPRED cccccEEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEEccccccHHEEEccccccccccHHHHHHccccccccHHHccccccHHHHHHHHHHHHcccccccHHHccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //