[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99059.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->57 PF01877 * DUF54 0.00066 31.0 42/120  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99059.1 GT:GENE ABD99059.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 295016..295222 GB:FROM 295016 GB:TO 295222 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99059.1 GB:DB_XREF GI:90820420 LENGTH 68 SQ:AASEQ MKIVIQTTKGTIESPEFPEIVREPLKEKIDKLADDLMDSWFNHSVYFRVDGWACILNKKEFISITLTD GT:EXON 1|1-68:0| HM:PFM:NREP 1 HM:PFM:REP 16->57|PF01877|0.00066|31.0|42/120|DUF54| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEEHHHEEEEEEcc //