Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99064.1
DDBJ      :             Hypothetical protein, phage associated

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids
:HMM:PFM   9->54 PF02321 * OEP 0.00079 8.7 46/188  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99064.1 GT:GENE ABD99064.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(296633..296806) GB:FROM 296633 GB:TO 296806 GB:DIRECTION - GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99064.1 GB:DB_XREF GI:90820425 LENGTH 57 SQ:AASEQ MNNMLSNEQIAHDLAIAFVSAKLSKETYISSDISVITAYEDAYSDFLRLLNKIRTVR GT:EXON 1|1-57:0| HM:PFM:NREP 1 HM:PFM:REP 9->54|PF02321|0.00079|8.7|46/188|OEP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,57-58| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHccc //