[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99071.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  7/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->207 PF06147 * DUF968 1.3e-34 26.4 159/200  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99071.1 GT:GENE ABD99071.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 298873..299589 GB:FROM 298873 GB:TO 299589 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99071.1 GB:DB_XREF GI:90820432 LENGTH 238 SQ:AASEQ MDNFEFKFDRIVGSKVQFEVDDLDAFKKELRKGHLKFNASPADHNMISNAQRKKIYALFRDISDYTGYEEQEVKNRLKLQFSYNTGYGNFSLSNCTKELATQFIRFVIEFCFRYDIPFDSKVMENTIDAERRVFLCLVHRQCTVCGSRQGLQINHEDTVGMGNNRNHIDHRNHRLEMLCFKHHSEFHNIGAKAFADKYHFHGIKLSDKSILSLKLMSQKQMDEFDEEYKRQKELNRNG GT:EXON 1|1-238:0| SEG 163->174|nnrnhidhrnhr| SEG 204->217|klsdksilslklms| HM:PFM:NREP 1 HM:PFM:REP 42->207|PF06147|1.3e-34|26.4|159/200|DUF968| OP:NHOMO 28 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------1----112-1113-1--1---1--------1------11-1-------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -1---------------------------------------------------------------------------1----------------------------1-11-1-1------------------------------------------------------------- DISOP:02AL 1-2,225-239| PSIPRED cccccEEEEEEEEEEEEcccHHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHHHccHHHHccccHHHHHHHHHHHEEEEccccEEEHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccEEEccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHccccEEEccccEEEEEEccHHHHHHHHHHHHHHHHHcccc //