[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99073.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   6->26 PF11348 * DUF3150 0.00042 38.1 21/257  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99073.1 GT:GENE ABD99073.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 300562..300765 GB:FROM 300562 GB:TO 300765 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99073.1 GB:DB_XREF GI:90820434 LENGTH 67 SQ:AASEQ MKKRIAEFKDAKGQFVKRYDKLVDKDGIQYMVSEHHDRYLVLVSLSDVRPPMPVIPSDLKNDYVKVG GT:EXON 1|1-67:0| HM:PFM:NREP 1 HM:PFM:REP 6->26|PF11348|0.00042|38.1|21/257|DUF3150| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 88.1 SQ:SECSTR #####EcccccccEEEEEEEccccTTTTcccccTTcHHHHHHHHTTcEETTEEcccGGGGcccH### DISOP:02AL 1-7| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccEEcc //