[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99081.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 41->89 ICA_PIG 8e-04 28.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99081.1 GT:GENE ABD99081.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 303160..303522 GB:FROM 303160 GB:TO 303522 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99081.1 GB:DB_XREF GI:90820442 LENGTH 120 SQ:AASEQ MNENIMAMVAELESNFPIKWEQHDKIKDLHFKIYDDRGYKFGIDKEFNEKRFDYMRFYYKGEKGEIYTLDETECIVRIPDKMSWEEFRGIGAILSITSKYMNSIKFNKMSELARVWKYDK GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 41->89|ICA_PIG|8e-04|28.6|49/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,120-121| PSIPRED ccHHHHHHHHHHHccccccHHcccccEEEEEEEEEcccccccccccccHHHHHEEEEEEEcccccEEEEcccEEEEEccccccHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHcccc //