[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99084.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->22 PF11396 * DUF2874 0.00031 26.3 19/54  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99084.1 GT:GENE ABD99084.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 304471..304713 GB:FROM 304471 GB:TO 304713 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99084.1 GB:DB_XREF GI:90820445 LENGTH 80 SQ:AASEQ MAKKYKIEFTDDDMENMKLYIDGEEKLINFLKLTYHIDESYKKDTKKVVLRYLEPNTYEVKFDVLGNQLGLLDIVPSDFD GT:EXON 1|1-80:0| HM:PFM:NREP 1 HM:PFM:REP 3->22|PF11396|0.00031|26.3|19/54|DUF2874| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,80-81| PSIPRED cccEEEEEEccccccEEEEEEEcHHHHHHHHHHHEEEcHHHHHHHHHHHHEEEcccEEEEEEEEEccEEEEEEccccccc //