[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99085.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->110 PF02391 * MoaE 0.00014 30.2 53/117  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99085.1 GT:GENE ABD99085.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 304728..305168 GB:FROM 304728 GB:TO 305168 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99085.1 GB:DB_XREF GI:90820446 LENGTH 146 SQ:AASEQ MKYLGTNEAMPAKVGSYKGYRYFIIPSLFGALNGYIELPKSWKDGDEDELTVHGGVTFKGYVRDGASKVKVIGFDTLHAFDDQETRDLKSIEKECKYMIDEMIEVMAKHRPLRANTEITLELADELGKLAAKQGLSFDELGYLHKK GT:EXON 1|1-146:0| TM:NTM 1 TM:REGION 19->41| HM:PFM:NREP 1 HM:PFM:REP 56->110|PF02391|0.00014|30.2|53/117|MoaE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,145-147| PSIPRED cccccccccccccccccccEEEEEHHHHHHHHccEEEcccccccccccEEEEEccEEEEEEEEccccEEEEEEEHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEHHHHHHHHHHHccccHHHHHHHHcc //