[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99086.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->46 PF00625 * Guanylate_kin 0.00088 24.3 37/183  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99086.1 GT:GENE ABD99086.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 305179..305460 GB:FROM 305179 GB:TO 305460 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99086.1 GB:DB_XREF GI:90820447 LENGTH 93 SQ:AASEQ MGKAYFNVEDIYGNRHREVETIREMDNTVLVFDIDDHETYTIRKEDVGMKLNRPAIRREKFNLSQNKRIWRNHQKELKDIRYKYARKVYSGIE GT:EXON 1|1-93:0| HM:PFM:NREP 1 HM:PFM:REP 9->46|PF00625|0.00088|24.3|37/183|Guanylate_kin| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,93-94| PSIPRED cccEEEEHHHHHcccHHHHHHHHHcccEEEEEEEccccEEEEEHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //