[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99089.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->76 PF00092 * VWA 0.00014 11.3 71/179  
:BLT:SWISS 4->72 SYC_THESQ 2e-04 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99089.1 GT:GENE ABD99089.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 306272..306517 GB:FROM 306272 GB:TO 306517 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99089.1 GB:DB_XREF GI:90820450 LENGTH 81 SQ:AASEQ MYKMIKFIGSEVTKSTQKINNSILMFNSVVFDRKNISFSSKYKVPKDDKSSIREDYKRIGKDIYKVLNNYEQRNQKRLAEQ GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 4->72|SYC_THESQ|2e-04|30.8|65/460| HM:PFM:NREP 1 HM:PFM:REP 5->76|PF00092|0.00014|11.3|71/179|VWA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,45-50,73-82| PSIPRED cHHHHHHHHHHHHHHHHHcccHHHEEHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //