[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99099.1
DDBJ      :             Major head protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  15/175   --->[See Alignment]
d.183.1
:398 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   180->384 3e8kG PDBj 2e-23 13.8 %
:RPS:SCOP  136->384 1ohgA  d.183.1.1 * 1e-22 13.1 %
:HMM:SCOP  110->384 1ohgA_ d.183.1.1 * 5.7e-34 21.7 %
:RPS:PFM   119->379 PF05065 * Phage_capsid 1e-12 28.8 %
:HMM:PFM   118->381 PF05065 * Phage_capsid 7.5e-54 29.2 250/276  
:BLT:SWISS 44->203 CYP37_ARATH 5e-04 27.0 %
:BLT:SWISS 250->362 ASPD_NITMS 5e-04 28.2 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99099.1 GT:GENE ABD99099.1 GT:PRODUCT Major head protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 313172..314368 GB:FROM 313172 GB:TO 314368 GB:DIRECTION + GB:PRODUCT Major head protein GB:PROTEIN_ID ABD99099.1 GB:DB_XREF GI:90820460 LENGTH 398 SQ:AASEQ MNINELNNAWIESGQKVADLNMQINAALIDDNYDEEKFANLKAQRDKEVTRRDNLKEQLDTARAEEVYNMPDKDKKPLSDSEKNLKDKFVENFVGMMNGNSKIVDMVTSSVDDNGDKAGLTIPSDVQTAIHQLVRQFNSLEQYVNREAVSMPTGSRVYEKWTDVTPLANLDDETAEIGDNDDPKLTLIKFAIKRYAGITTVTNTLLKDTAENILAWLSAWIAKKVVVTRNKAIIDVMSAVPKKPTITDFDGVIDLVNTGVDPAIKTTSFLMTNTSGLNTLSKVKDAMGRYLLQHDPTQPDVYMIKGKRVIEIADRWLPDNAGSHPLYYGDLKQAVTLFDRENMSLLSTNIGDGAFKRDLTKVRVIDRFDVVATDSEAWVAGSFKTIKDQEAKLATNNA GT:EXON 1|1-398:0| BL:SWS:NREP 2 BL:SWS:REP 44->203|CYP37_ARATH|5e-04|27.0|148/466| BL:SWS:REP 250->362|ASPD_NITMS|5e-04|28.2|110/100| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 35->62| RP:PDB:NREP 1 RP:PDB:REP 180->384|3e8kG|2e-23|13.8|196/247| RP:PFM:NREP 1 RP:PFM:REP 119->379|PF05065|1e-12|28.8|243/271|Phage_capsid| HM:PFM:NREP 1 HM:PFM:REP 118->381|PF05065|7.5e-54|29.2|250/276|Phage_capsid| RP:SCP:NREP 1 RP:SCP:REP 136->384|1ohgA|1e-22|13.1|237/280|d.183.1.1| HM:SCP:REP 110->384|1ohgA_|5.7e-34|21.7|263/0|d.183.1.1|1/1|Major capsid protein gp5| OP:NHOMO 67 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--1-11------------1----1-----1-1--1----------------1-----112213-1111-3-1-----1--------------1-1111--11-11-------------------131--1-1----111-1---------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------111---1--------------1-1--1-1--1--------1-----11-11---------------1-------------------------- STR:NPRED 237 STR:RPRED 59.5 SQ:SECSTR ###############################################################################################################################################ccccccccccccEEEEEEEcccEEEEEEEcccccccccccEEEEEEEEcEEEEEEEEEcTTTTccHHHHHHHHTTTTHHHHHHHHHHHHHHcEccGGGccTTccHHHHHHHHHHHHHHTTTccccEEEccTTTTHHHHTcEETTTEEccccccccccccccTTcccccccc####TTccTTEEEEEcHHHHcEEEEEEEEEEEEEcccTTTTTcccEEEEEEEEEEEccccGGGEEEEEcc############## DISOP:02AL 1-1,67-90,106-113,392-392,394-399| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccEEEcHHHHHHHHHHHHHHccHHcEEEEEEEEcccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccHHHHHHHHHccccHHHHcccEEEEcHHHHHHHHHHHcccccEEEcccccccccccccccEEEEEEcHHccccccccEEEEEEHHcEEEEEEccccEEEEEEcccccccccEEEEEEEEEEEEEEEccccEEEEEEEEHHHcccccccccc //