[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99103.1
DDBJ      :             Phage tail protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->117 PF05657 * DUF806 3e-18 44.7 %
:HMM:PFM   3->121 PF05657 * DUF806 1.1e-49 49.2 118/123  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99103.1 GT:GENE ABD99103.1 GT:PRODUCT Phage tail protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 315437..315814 GB:FROM 315437 GB:TO 315814 GB:DIRECTION + GB:PRODUCT Phage tail protein GB:PROTEIN_ID ABD99103.1 GB:DB_XREF GI:90820464 LENGTH 125 SQ:AASEQ METPTTIAKKLMKDITWIDELYSGSIPSNVEVNTNKNTVLITEYLNEPSQYANMEIKYWLVGVEVQIFYKLDGEDFQNCEIQVARLFNDNRWKIDTSRNRIKDPDTKQWTKVFYFSKNLEMEEGI GT:EXON 1|1-125:0| RP:PFM:NREP 1 RP:PFM:REP 4->117|PF05657|3e-18|44.7|114/123|DUF806| HM:PFM:NREP 1 HM:PFM:REP 3->121|PF05657|1.1e-49|49.2|118/123|DUF806| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--1111-1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------1----1--------------1-------------------------1--------------------------------------------- DISOP:02AL 1-1,124-126| PSIPRED cccHHHHHHHHHHccccHHHHHcccccHHHHccccccEEEEEEccccccccccccEEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHcccEEEEcccccccccccEEEEEEEEEEEEHHHccc //