[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99104.1
DDBJ      :             Phage major tail protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  8/175   --->[See Alignment]
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->144 3gqnA PDBj 4e-04 30.9 %
:RPS:PFM   35->206 PF04630 * Phage_tail 5e-23 46.3 %
:HMM:PFM   5->208 PF04630 * Phage_tail 5.9e-81 51.8 195/199  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99104.1 GT:GENE ABD99104.1 GT:PRODUCT Phage major tail protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 315816..316520 GB:FROM 315816 GB:TO 316520 GB:DIRECTION + GB:PRODUCT Phage major tail protein GB:PROTEIN_ID ABD99104.1 GB:DB_XREF GI:90820465 LENGTH 234 SQ:AASEQ MAKSSTHGVRYIGLATIDDSGVLLKGQSGLSDNGIYIIDGKGEGTITANITGLEQAGTPVYANNQVKLIQHGKQQPQVALTVLNMNNDVLNKIKGYVSDGKGGYVLSSGDKPNVALLLCSEDVDGTLIYEGFSHGEVTETGRNHGTDNNNLTRADATLTFQALEPLKADIFMDDKGVQQPYKVWADDEPGFDLNLMYKEVFGGFSDVQSLRIPKKFKTTTVTQTSASPTSVTAQ GT:EXON 1|1-234:0| SEG 218->233|tttvtqtsasptsvta| BL:PDB:NREP 1 BL:PDB:REP 20->144|3gqnA|4e-04|30.9|110/767| RP:PFM:NREP 1 RP:PFM:REP 35->206|PF04630|5e-23|46.3|162/171|Phage_tail| HM:PFM:NREP 1 HM:PFM:REP 5->208|PF04630|5.9e-81|51.8|195/199|Phage_tail| OP:NHOMO 19 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--1111-2-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------11---1--------------1------------------------11-11------------------------------------------ STR:NPRED 110 STR:RPRED 47.0 SQ:SECSTR ###################EEEEEEccTT#ccEEEEEcccTTccEEEEEccccEETTcccEEEEEEEEEcTTcccccEEEEEcccccEEEE##############EEEEcccEEEEEcccEETTccccccccEEEccccEEEEc########################################################################################## DISOP:02AL 1-4,228-235| PSIPRED cccccEEEEEEEEEEEEcccccEEcccccccccEEEEEccccccEEEEEEEEcccccEEEEEccEEEEEEEcccccEEEEEEccccHHHHHHHccEEEcccEEEEEccccccEEEEEEEEEcccccEEEEEEcccEEEccccccccccccccccccEEEEEEcccEEcccccccccccccEEEEccccccccHHHHHHHHccccccccEEEcccccccEEEEEcccccccEEcc //