[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99109.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
:275 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->273 PF05709 * Sipho_tail 1.8e-39 24.2 219/248  
:BLT:SWISS 107->226 HMU_HALWD 7e-05 31.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99109.1 GT:GENE ABD99109.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 321431..322258 GB:FROM 321431 GB:TO 322258 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99109.1 GB:DB_XREF GI:90820470 LENGTH 275 SQ:AASEQ MENNFYIKYGNNPEFSLKDITSNLTLLKLDENPSISNVYQNNVMQDGEMWNYTTYQPTTVSCTFLLWFSTWQDYLLAKHDIMQAFMQKELFRIRTDIDKHLVRYVRTAPFTIAPNEDGSHWATFTVAFENPSGVKYSYLRSDQISQSNGWGYGLNLADVPNLNYHFNNQTSFRIFNASDIAVDPYFQKHDLKITIKSANGGLTVKNTTNETSWTFKGSLNSNDTVVLDGINTYKNNSYDSMETDFGYIKLEKGWNEITLDKVADITFSFPFIYTF GT:EXON 1|1-275:0| BL:SWS:NREP 1 BL:SWS:REP 107->226|HMU_HALWD|7e-05|31.0|116/100| HM:PFM:NREP 1 HM:PFM:REP 31->273|PF05709|1.8e-39|24.2|219/248|Sipho_tail| OP:NHOMO 34 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---2-11---1--------21112------1111-1111--11-----------1----122---2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------1---------------------------------1-----------------------------------1-------------------------- DISOP:02AL 1-2| PSIPRED ccccEEEEcccccccEEEEEEEEEEEccccccccccEEEEEccccccccccccEEccEEEEEEEEEEEccHHHHHHHHHHHHHHHccccEEEEEEcccccEEEEEccccccccHHHccccEEEEEEEEEEcccEEEEEcccccccccccccccccccccccEEEEEEcccEEEEEcccccccccHHHcccEEEEEEcccccEEEEEcccccEEEEEEEEccccEEEEEEEEEEEccccccccccccEEEEcccccEEEEEccEEEEEEEEEEEEc //